KEGG   Drosophila grimshawi: Dgri_GH18611Help
Entry
Dgri_GH18611      CDS       T01061                                 

Definition
(RefSeq) GH18611 gene product from transcript GH18611-RA
Organism
dgr  Drosophila grimshawi
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase Abhydrolase_6 Lipase_2
Motif
Other DBs
NCBI-GeneID: 6563238
NCBI-ProteinID: XP_001989775
FlyBase: FBgn0126078
UniProt: B4JHL0
AA seq 495 aa AA seqDB search
MQEMDESNHSYADYRAQQVVDADNNQLRAEEDVEEDTQEIGASAKQIPAVQVKVTNEVES
AMMMMMRATEVEEKQQLQQPNGNGQDEKDRPDIHNVMAGDEGVNVGVGLMSPNALPISER
HNFDDDNNNNKSNNNSSSSNAGQMVGDEQLLRLQDYNLLYNAERQTYFQLHSCNDHPPMN
RPSLSSGNRLLQQVVGNTLSAAFGLNANAVRPTAMQQMTTQTVRLYDAVSLRQSRFNPFN
PTRIIIHGWLGNAYANIYSYLVPAYLSLDDGNYNIFTVDWGRGAIADYITASYRVKPVGQ
VLAKFLDFLHKEAGMRFEDLQLIGFSMGAHVAGLASKHVLTGRVRVIRALDPAQPFFRYA
QERERLDKGDAYYVEVLHTSVGSYGFDRPLGHVDFYANWGSQQPGCFWHECSHWRAFALF
KESLEARGAAFEAKGCLPSAWQELIRYKRCTQPTGQRLHMGGDLGALSMQQLTQREGVYY
FETPAKPPYATLKKT
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcaggagatggatgagtcaaaccactcctatgctgattacagagcacagcaggttgtt
gatgcagacaacaatcaattgcgggcggaggaggatgtcgaggaggatacacaagagata
ggggcaagtgcaaagcagatacccgcagtgcaagtaaaagtgacaaatgaagtggaaagt
gccatgatgatgatgatgagggcgacagaagttgaggaaaagcagcaactgcaacaaccc
aatggcaatgggcaggacgaaaaggacagaccagatatacataatgtaatggccggcgac
gagggcgtgaacgtgggcgttggcctaatgagccccaatgcgctgccaatatcggaaagg
cataattttgacgacgacaacaacaacaacaaaagcaataataacagcagcagcagcaac
gctggccaaatggttggcgatgagcaactattgcgattgcaggactacaatttactgtac
aatgccgaacggcagacatactttcaactgcactcgtgcaatgaccatcctccaatgaat
aggccgtccttgtcgagtggtaatcgactgttgcagcaggtcgttggcaatacgctgagt
gccgcatttggcctgaatgcgaatgcggtgaggcctacagccatgcagcagatgaccaca
caaacagtgcggctctatgatgccgtctcgttgcgacagtcccgcttcaatcccttcaat
cccacgcgcatcatcatacatggctggctgggcaatgcatatgcgaacatttatagttat
ttggtgccggcctatttgagtctggacgatggcaattacaacatattcaccgtggactgg
ggtcgtggtgccatagcggactatataacagccagttatagggtgaagcctgtgggtcaa
gttctggccaagtttctggattttctgcacaaggaggcgggcatgcggtttgaggatctg
cagctgattggctttagcatgggcgcccatgtggctggtcttgcctcgaagcacgtgctg
acgggtcgtgtgcgtgtgattcgtgccctagatccggcacagcccttcttccgttacgca
caggagcgggagcgattggataagggggatgcgtactatgtggaggtgctgcacacaagc
gtcggcagctacggcttcgatcgcccgctgggccatgtggatttctatgccaattggggc
agccagcagccgggctgcttctggcacgagtgcagccactggcgtgcctttgcgctcttc
aaggagagcctggaggctcggggtgctgccttcgaggccaagggttgtctgcccagtgcc
tggcaggagttgatacgctacaagcgttgcacgcaaccaacgggacagcgtcttcatatg
ggcggtgatttgggcgcattatcaatgcagcagttgacgcaacgtgagggcgtttattat
tttgagaccccagcaaaaccgccctacgctacactcaaaaaaacatga

DBGET integrated database retrieval system