KEGG   Drosophila grimshawi: Dgri_GH19140Help
Entry
Dgri_GH19140      CDS       T01061                                 

Definition
(RefSeq) GH19140 gene product from transcript GH19140-RA
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
dgr  Drosophila grimshawi
Pathway
dgr00350  Tyrosine metabolism
dgr01100  Metabolic pathways
Module
dgr_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Dgri_GH19140
Enzymes [BR:dgr01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     Dgri_GH19140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-GeneID: 6563082
NCBI-ProteinID: XP_001990076
FlyBase: FBgn0126607
UniProt: B4JEK7
AA seq 247 aa AA seqDB search
MSALRKSTISLLNLAGNGTRRLSSSDAKPVLYSYYASSCAWRVRIALGLKGIPYEIKATH
LFEPNAPLYSNSSEYQEINPTQLVPALKIDGQILCDSVAIMHYLEQTKPQQPLLPQDPFK
RAKVLQIVQIICSGIQPLQNASVLDRVGKKNSLEWAQYWISSRFAGLEKVLSASSGKFCV
GDEISMADCCLVPQVFNARRFRVNLNPFPTIVKLDDSFGTQSAVRASHPYNQPDCPPELA
NKQKISK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgttaagaaaatcaactataagtttactgaatctggctggaaatgggacacgc
aggttaagttcgagcgatgcaaaaccagtgctctactcgtactacgccagctcttgtgca
tggcgggtgcgaattgcattgggattgaagggtataccatatgaaatcaaagcaacccat
ctttttgaaccaaatgctccactatacagcaattcgagtgagtatcaggaaataaaccca
acgcaactggtacctgctctaaaaattgatggccaaatactctgtgattccgtggccatt
atgcactacctggaacaaacaaaaccccagcaacctcttctgccacaggatccgtttaag
cgtgccaaggtgctacagattgtgcaaatcatttgctccggcattcagccgctgcaaaat
gccagcgtattggaccgtgtgggcaaaaaaaatagcttggagtgggctcagtattggata
tcaagccgttttgctggtctggagaaggtgctctctgcatcgtccggtaaattctgtgtt
ggggatgaaatttccatggctgattgctgccttgttccacaggtgtttaatgccagaagg
ttccgagttaacttgaatccctttcccacgatagtaaaactcgatgacagttttggaaca
caatcagctgttcgtgcctctcatccttataatcaacccgactgtccaccagagctggca
aataaacaaaagattagtaaatga

DBGET integrated database retrieval system