KEGG   Drosophila grimshawi: Dgri_GH19192Help
Entry
Dgri_GH19192      CDS       T01061                                 

Definition
(RefSeq) GH19192 gene product from transcript GH19192-RA
  KO
K17610  calcineurin B homologous protein 1
Organism
dgr  Drosophila grimshawi
Brite
Protein phosphatases and associated proteins [BR:dgr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Dgri_GH19192
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_5 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 6563042
NCBI-ProteinID: XP_001990176
FlyBase: FBgn0126659
UniProt: B4JEV7
AA seq 189 aa AA seqDB search
MGNKSSLFLRHEEIAQIQNETGFTPNQIERLYSRFTSLDRNDCGTLSREDLMRIPELAIN
PLCERIVHSFFVESTDDRVNFRQFMNVLAHFRPLRDNKQSKLNSREDKLKFAFQMYDLDD
DGVISRDELLSILHMMVGANISQDQLTSIAERTILEADLCCQGKISFEDFCKALERTDVD
QKMSIRFLN
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacaaatcatctcttttcctgcgacacgaggaaattgcacaaatacaaaatgaa
acgggatttactcccaatcaaattgagcgtctttattcgcgcttcacctcgctggatcgc
aacgattgtggcaccctgtcgcgcgaagatctgatgcgcatcccggagctggccatcaat
ccgctgtgcgagcgcattgtgcactccttctttgtggagagcaccgatgatcgggtgaac
ttccgccaattcatgaatgtgctggcccatttccgtccgttgcgggacaataagcagagc
aaactgaatagtcgcgaggataagctgaagttcgccttccagatgtacgatctggacgat
gatggcgtcattagtcgcgacgagctgctctccattctgcacatgatggtcggtgcgaac
atcagtcaagatcagttgaccagcattgcggagcgtacgattctggaggcagatctgtgc
tgccagggcaagatctcgttcgaggacttctgcaaggcgctagaacgcaccgatgtcgat
cagaagatgtccatacggtttctcaattaa

DBGET integrated database retrieval system