KEGG   Drosophila grimshawi: Dgri_GH19289Help
Entry
Dgri_GH19289      CDS       T01061                                 

Definition
(RefSeq) GH19289 gene product from transcript GH19289-RA
  KO
K01769  guanylate cyclase, other [EC:4.6.1.2]
Organism
dgr  Drosophila grimshawi
Pathway
dgr00230  Purine metabolism
dgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Dgri_GH19289
Enzymes [BR:dgr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     Dgri_GH19289
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HNOBA HNOB Guanylate_cyc Gmad2
Motif
Other DBs
NCBI-GeneID: 6563530
NCBI-ProteinID: XP_001990341
FlyBase: FBgn0126755
UniProt: B4JFC2
AA seq 664 aa AA seqDB search
MYGMLYESVQHYVQKEYGKEVWSKVCHIVDCKHNSFKTHQIYPDKLMPDFAAALSAVTGQ
SFDFCMNFFGKCFVRFFSNFGYDKMIRSTGRYFCDFLQSIDNIHLIMRFTYPKMKSPSMQ
LTSMDDNGAVILYRSGRTGMSKYLIGQMTEVASEFYGLQIKAYVIESQNDISGGTAGPIK
LTDGPLTVIVKYRLDFDNREYMAKRVNTEAHPSQYRMPQVNLNVFLDLFPFTIVLNHDMK
ITHAGEKVVETWIMHNPGVNPKSFIGTYVMDLFHCRRPKDTTITWDTLIQMRAVLFEFEL
IRTGHNRAAYEAVLNMDLENYDDMVLNEAQTTALQKTKDLAEKLEEESGDEREIDPATGE
RRSSDGVRSILLKGQMFYIKDVDSLIFLCSPLIENLDELHGIGLYLNDLNPHGLSRELVM
AGWQHCSKLEMLFEKEEERSDELEKSLELADLWKRQGDELLYSMIPRPIAERMRLGREHV
CQSFEEVSVIFIEVMNIYDSGSNNVQEAMQAVNTLNQVFSAIDEEIISPFVYKVETVGMV
YMAVSGAPDINPLHAEHACDMALRVMKRIKSHNLPDVAIRVGINSGPVVAGVVGMKVPRY
CLFGDTVNTASRMESSGDPWKVQLSGYTAEKVQTAGYKVESRGTVKVKGKGDMETFWLVE
GPEE
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtatggaatgttgtatgagagtgtccagcactatgtgcagaaagaatacggcaaagaa
gtttggtcaaaagtttgccacattgtggactgcaagcacaacagctttaagacccatcag
atatatccggataagctgatgccagatttcgcagcagctctatccgcagtaacgggccag
tcctttgacttttgcatgaacttctttggcaaatgttttgtgcgtttcttcagcaacttt
ggttacgataaaatgatacgctccacgggtcggtatttctgtgatttcctgcagtccatc
gataatatccatttgattatgcgcttcacctatccgaagatgaagtcacccagcatgcag
ctgaccagcatggatgacaatggagcggttatattatatcgtagtggtcgcaccggcatg
tccaagtacctcatcgggcagatgacggaggtggccagtgagttctatggcctgcagatc
aaagcctatgtgatcgagagtcagaatgatatatccggcggcactgctggacccattaaa
ttgacagacggtcctctaacggttatagtcaaatatcggctggactttgataatagagaa
tatatggccaagcgtgtgaatactgaagcgcatccttcgcagtacaggatgccgcaagta
aacttgaatgtgttcctggatctgtttcctttcacgattgtcttaaatcatgatatgaag
ataacgcatgctggcgagaaagttgttgagacgtggataatgcacaatcccggagtcaat
cccaagtccttcattggcacatatgtcatggatctgtttcactgccgtcgccccaaggat
accaccattacctgggacactttgattcagatgcgagcggtgctcttcgagttcgagctc
atacgcaccgggcataatcgagccgcctatgaggctgtgctcaacatggaccttgagaac
tatgatgacatggtcctgaacgaggcccagactacagcgctgcagaagaccaaggattta
gcggagaaactggaagaggagtctggtgacgagcgggaaatcgatccggcaacgggcgaa
cgccgatcttcggatggtgttcgctccattctactcaagggacagatgttctacattaag
gatgtggactctttgatctttctgtgcagtcctctgatagagaatcttgatgagctgcat
gggattggtttgtatctaaatgatctaaatccacatggcctgagccgtgaactggtgatg
gcgggctggcagcattgttccaagctagagatgttgttcgagaaagaggaagagcgctct
gatgagctggaaaaatctttggaattggcggacttgtggaagcgtcaaggcgatgagctg
ttgtactccatgataccccgtcccattgcagaacgcatgcgattgggacgtgaacacgtc
tgccagagctttgaggaggtttccgtcatattcatagaagtcatgaatatctacgacagc
ggctcaaataacgtccaagaagccatgcaggctgttaatacgctcaaccaggtgttttca
gcaatagatgaggagatcatatcaccatttgtctataaggtggaaactgtgggcatggtc
tatatggcggtatccggagcaccggatatcaatcctctacatgccgagcacgcttgtgac
atggcgctgcgcgttatgaaaaggattaagtcccacaatctgccagatgtggctattcga
gtaggtatcaactcgggtccagtcgtcgctggggtagttggcatgaaggtgccgaggtat
tgcctgtttggagatactgtgaatacggcctcacgcatggagagcagcggcgatccgtgg
aaggtgcagttgtccggttatacggccgaaaaggtgcaaactgcgggctacaaggttgag
tcacgcggtacagttaaagtcaagggaaagggcgacatggaaaccttttggcttgtggaa
ggacctgaggaatga

DBGET integrated database retrieval system