KEGG   Drosophila grimshawi: Dgri_GH19679Help
Entry
Dgri_GH19679      CDS       T01061                                 

Definition
(RefSeq) GH19679 gene product from transcript GH19679-RA
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
dgr  Drosophila grimshawi
Pathway
dgr00450  Selenocompound metabolism
dgr00970  Aminoacyl-tRNA biosynthesis
dgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Dgri_GH19679
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Dgri_GH19679
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dgr01007]
    Dgri_GH19679
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dgr03016]
    Dgri_GH19679
Enzymes [BR:dgr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Dgri_GH19679
Amino acid related enzymes [BR:dgr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Dgri_GH19679
Transfer RNA biogenesis [BR:dgr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Dgri_GH19679
 Prokaryotic type
   Other AARSs
    Dgri_GH19679
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-GeneID: 6570386
NCBI-ProteinID: XP_001996635
FlyBase: FBgn0127143
UniProt: B4K031
AA seq 578 aa AA seqDB search
MFVSKIRHIQALGARWSSSHYVTTPIFYVNAAPHIGHLYSAVIADAHCRYQRLRYPTTTV
RLCTGTDEHGTKIQQAAAGHKVPVDQYCDEISARYRDVFKAASIAHDDFIRTTEQRHKQA
VAHFWHRLKSRGHIYSAAYSGWYCVSDETFLTDSQLRLDESSGTRYSLESGHPVEWTEET
NYMFRLSNFQDDVRHWVKQEARVRPAKFEKILLDTLSEPLPDVSVSRPANRVHWAIPVPN
DDSQTVYVWLDALINYLSSLGYPNEEYLAYWPPAQQIIGKDILKFHGIYWPAFLLAAGLS
PPQQLYVHSHWTVDGQKMSKSKHNVVDPVLAAKQYTMEGLRYFLLREGVAHSDGNFSHVK
ALRILNSELADTLGNLLSRACAKTLNPHQVYPASHVEHLPQLLQDLDAAKRLQEALLQLA
GRCEQHYECNHFHLVADTVIATLHAANNFFECAKPWELKANGKTPDAQRLQTIIAMTMDA
LRLCGIVLQPMMPQLTSRLLDKLNVPSSERSWHHLNASFATGKQHNHQLDNQWSALLFQR
IVEHQDKSTQEEQQQSSPSQSSKRSKTKKDQKAAKTIS
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgtttgttagtaaaataaggcatatacaagcgttgggagcacgttggagcagttctcac
tacgtgacaacaccgatattttacgtaaatgcagctccacacattggtcatctgtattcg
gcggtgatagctgatgcgcattgccgataccagaggctgcgttatccgacaaccacagtg
cgcctctgcaccggcaccgatgagcacggcacgaagattcaacaggcggcagctggacac
aaggtgcccgtggatcaatattgcgatgagatatcggcgcgttatcgtgatgtgtttaaa
gcagcaagtatagcgcacgacgactttatacgcaccaccgagcagcgacacaaacaggcc
gtagcacacttctggcacaggctgaagtcacgtggccatatttattcggcggcctacagc
ggctggtattgcgtatcggatgagacctttctgaccgactcacagctgcgcctagacgag
agcagcggcacacgctactccctggagtcaggccatcctgtcgagtggactgaggaaacg
aattacatgtttcgactgtcaaactttcaagacgatgtgcgtcattgggtcaagcaggag
gcacgcgtgcggccagcgaagttcgagaagattctgctcgatacgctgagcgagccgctg
ccggatgtgtccgtctctcgtccagcgaatcgggtacactgggcgatacccgtgccgaat
gatgacagccaaacagtgtatgtgtggctagatgctctcatcaactatctcagctcctta
ggctatcccaatgaggagtatttagcttactggccacccgcgcagcaaatcattggaaag
gacatactcaaattccatggcatttattggccagcctttttgttggcagccggcctgtcg
ccaccacagcaactatacgtccactcgcactggacggtggacggccagaagatgtcgaag
agcaagcacaacgttgttgatcctgtgctggcagccaaacagtatacaatggagggacta
cgttactttctgttgcgcgagggcgttgcacacagcgatggcaatttcagtcacgttaag
gcgttgcgcatactaaactcagagctggcggacactttgggcaatttgttgtcacgggcc
tgtgccaaaacgctgaatccacatcaagtttatcccgcgtcgcatgtcgagcacttgcca
cagctgctgcaagacttggatgccgctaagcgactgcaggaggcactcctgcaactggca
gggcgctgtgagcagcactatgagtgcaatcacttccacttggtggccgacacggttatt
gcaacgctgcatgcggccaacaatttctttgagtgcgccaagccctgggagctgaaagcg
aacggcaaaacgcccgatgcgcaacgcctgcagacaataatcgcaatgacaatggatgcg
ttgcgactttgcggcattgtgttgcagccaatgatgccacagctaaccagccgcctgctc
gataaacttaacgtgcccagctctgagcgtagttggcatcatttgaacgctagctttgcc
actggcaagcaacacaatcaccagctggataaccagtggagtgcattgctattccagcgc
attgtggagcatcaggataaatctacacaagaggagcagcagcaatcatctccgtcgcag
tcgtccaagcgaagcaaaaccaaaaaggaccagaaggcagcaaagacaatttcttga

DBGET integrated database retrieval system