KEGG   Drosophila grimshawi: Dgri_GH19714Help
Entry
Dgri_GH19714      CDS       T01061                                 

Definition
(RefSeq) GH19714 gene product from transcript GH19714-RA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
dgr  Drosophila grimshawi
Pathway
dgr00480  Glutathione metabolism
dgr00980  Metabolism of xenobiotics by cytochrome P450
dgr00982  Drug metabolism - cytochrome P450
dgr00983  Drug metabolism - other enzymes
dgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Dgri_GH19714
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dgri_GH19714
   00982 Drug metabolism - cytochrome P450
    Dgri_GH19714
   00983 Drug metabolism - other enzymes
    Dgri_GH19714
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dgr02000]
    Dgri_GH19714
Enzymes [BR:dgr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Dgri_GH19714
Transporters [BR:dgr02000]
 Other transporters
  Pores ion channels [TC:1]
   Dgri_GH19714
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-GeneID: 6560626
NCBI-ProteinID: XP_001987875
FlyBase: FBgn0127178
UniProt: B4J4N7
AA seq 221 aa AA seqDB search
MASKPVLYYNSRSPPCRGVLLTAAALGLDLDLRSLTVKAGENMTPQFLKLNPLHTIPVLD
DNGTVVSDSHVICCYLVDKYAKDGDALYPKDPAQRREVDARLYFDCGHLFPRVRFIVEPL
FYFGATAIPEDRITYMQKAYDGLEHCLATAPYLAGANLTIADLCSVSSVSTAAAFAPIDA
EKYPKLSQWLARLQALPYYKANNEEGLQILIKLAKSVLVEQ
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaaaccagttctctattataattcacgcagtccgccatgccgtggggtgctt
ctcacagccgctgctctgggactcgacctggatctccgctcgctgaccgttaaggctggt
gagaatatgacgccacaatttctcaaactaaatccactgcatacaatcccagtgctggat
gacaatggcactgtggtcagcgattcgcatgtgatctgttgctatctggttgacaagtat
gccaaggacggtgacgcactgtatcccaaggatccagcacaacgacgcgaggtcgatgca
cgtctctacttcgattgcggccatctgtttccacgtgtgcgtttcattgtggagccgctg
ttttactttggcgccacagcaatacccgaagatcgcatcacatacatgcagaaggcttac
gatggactggagcactgcctggccacagctccatatctcgctggtgcgaacctaaccatt
gcggatctatgcagcgtgtcgtcggtgtcaacggcggctgcctttgcgcccatcgatgcg
gagaagtatcccaagctgtcacaatggttggccagattgcaggcgctgccctactacaag
gctaacaatgaagagggccttcagatactaattaagttggccaaaagtgtgctggtcgag
caataa

DBGET integrated database retrieval system