KEGG   Drosophila grimshawi: Dgri_GH19915Help
Entry
Dgri_GH19915      CDS       T01061                                 

Definition
(RefSeq) GH19915 gene product from transcript GH19915-RA
  KO
K00787  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
dgr  Drosophila grimshawi
Pathway
dgr00900  Terpenoid backbone biosynthesis
dgr01100  Metabolic pathways
Module
dgr_M00367  C10-C20 isoprenoid biosynthesis, non-plant eukaryotes
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dgri_GH19915
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:dgr01006]
    Dgri_GH19915
Enzymes [BR:dgr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     Dgri_GH19915
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     Dgri_GH19915
Prenyltransferases [BR:dgr01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   Dgri_GH19915
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-GeneID: 6559968
NCBI-ProteinID: XP_001987531
FlyBase: FBgn0127379
UniProt: B4J8V8
AA seq 413 aa AA seqDB search
MFKLAQKLLPRQRVLQRSAVVRRLISTSDEVKSVDTIGGLPTEIVNEQKLKKTTRTLSTL
QNHSVPIAARVTVSKDESRDFMAVFPDVVRDLTNATKAYNCRDAAKWFAQVLQYNVPRGK
KNRGILTVLTYKNLVPADQLTPENIKLAQYLGWCVEMLQSFFIISDDVMDNSTTRRGQKC
WHMVENVGLNAINDALMIENAMYAILKQHFSHLDCYVALMELFHEITYITTCGQSLDLLN
SNKSVSEFSMDNYKAIVENKTAYYSFYLPFAIAMHLAGYKDPEAFRQSKTILLEMGNFFQ
VQDDFLDCFGNPEVTGKIGTDIQDNKCSWLAVVAMQRANAEQKQIMIDCYGQTDPLKVER
VKELYKELSLPSTYAIFEEESYNMIKTHIQQTSRGVPHQTFLQILNKIYQRDS
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagctagcacagaaattgctgccgcggcagcgagttctccaacgttccgccgtt
gtgcgtcgcttgatttcgacgagcgacgaggtaaaatctgtagacacaattggcggcctg
ccgacagagatagtcaatgagcagaaactaaaaaagacaaccagaacattatctacacta
caaaatcattcggtgccaattgctgctcgcgtcacagtttcaaaagatgaaagccgcgac
tttatggctgtttttcctgacgtggtgcgcgacctgacaaacgcaacaaaagcatacaat
tgcagggatgccgctaaatggtttgcccaggtcttgcaatacaatgttccgcgtggcaag
aagaatcgcggcatcttaacggtgctcacctataagaatctggtgccagctgaccaactc
acaccggagaacattaaactagcccagtatttgggctggtgtgtggaaatgctccagagt
ttctttattatatcggacgatgttatggacaacagcactacacgacgcggtcaaaagtgc
tggcacatggtagaaaatgtgggcctgaatgccattaatgatgccctaatgattgagaat
gccatgtacgccatactcaagcagcactttagtcatttggattgttatgttgcgctcatg
gaactcttccacgagataacatacataacaacctgtgggcagtcgctggacttactcaat
tcaaacaaaagcgtttcggagttcagcatggacaactacaaggcaattgtggaaaataaa
actgcctactactccttttacctgccctttgccattgcaatgcatttagccgggtacaaa
gatcccgaggcatttagacagtccaagaccatactgcttgaaatgggtaactttttccag
gttcaagacgacttcctcgattgcttcggcaatcccgaggtaactggcaaaatcggcact
gatatacaggacaacaagtgctcttggctcgctgtggttgccatgcagcgtgccaatgct
gagcaaaagcaaattatgatagattgctatggacaaactgatccgcttaaagtggagcga
gttaaggagctgtataaagaactcagcctgccctcgacatatgccatttttgaggaggaa
tcgtataatatgatcaaaacgcacatacagcaaacatctcgtggtgtgccacatcagacc
tttttgcaaatacttaacaaaatctatcaacgggactcgtaa

DBGET integrated database retrieval system