KEGG   Drosophila grimshawi: Dgri_GH21082Help
Entry
Dgri_GH21082      CDS       T01061                                 

Definition
(RefSeq) GH21082 gene product from transcript GH21082-RA
  KO
K16944  septin 7
Organism
dgr  Drosophila grimshawi
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dgr04131]
    Dgri_GH21082
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dgr04812]
    Dgri_GH21082
   04147 Exosome [BR:dgr04147]
    Dgri_GH21082
Membrane trafficking [BR:dgr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    Dgri_GH21082
Cytoskeleton proteins [BR:dgr04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     Dgri_GH21082
Exosome [BR:dgr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dgri_GH21082
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase AIG1 AAA_22 Pex14_N Ras FtsK_SpoIIIE AAA_29 Roc AAA_16 ABC_tran
Motif
Other DBs
NCBI-GeneID: 6561290
NCBI-ProteinID: XP_001985925
FlyBase: FBgn0128544
UniProt: B4J5U9
AA seq 541 aa AA seqDB search
MNSPRTNGAISALPSTLAQLALRDKQQAATASSIATATTASNGSDSTAVGAANATTTTTT
SQRPQTQPPSVPKLQLADSASVTSSNGDSNKLTHDLQEKEAQQQQKPQKPPLPVRQKPME
IAGYVGFANLPNQVYRKAVKRGFEFSLMVVGGSGLGKSTLINSMFLSDIYNAEQYPGPSL
RKKKTVAVEATKVMLKENGVNLTLTVVDTPGFGDAVDNSNCWVPILEYVDSKYEEYLTAE
SRVYRKSISDNRVHCCLYFIAPSGHGLLPLDIACMQSLSDKVNLVPVIAKADTMTPDEVH
LFKKQILNEIAQHKIKIYDFPATLEDAAEESKATQNLRSRVPFAVVGANTIIELDGKKVR
GRRYPWGIVEVENLTHCDFIALRNMVIRTHLQDLKDVTNNVHYENYRCRKLSELGLVDGK
ARLSNKNPLTQMEEEKREHEQKMKKMEAEMEQVFDMKVKEKMQKLKDSELEMARRHEERK
KALELQIHELDEKRREFEREKKEWEDVNHVTLEELKRRSLGGNSSTDNVDGKKEKKKKGL
F
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtcctcgcacaaacggcgccatctcagcgctgccgagcacattggcacagttg
gcgttgcgcgacaagcagcaggcggcgacagcatcatccatagcgacagcgacaaccgca
tccaatggaagtgattcaaccgcagtaggagcagcgaacgcgacgacgacgacgacgacg
tcgcagcgtccacagacgcagccgcccagtgtgccaaaactgcagttagccgactcggcc
agtgtgaccagctcaaatggtgactcgaacaagttaacccacgatttgcaggaaaaggaa
gcccagcagcagcaaaagccacagaaaccaccgttgcccgtgcgacagaaaccaatggaa
attgccggctatgtgggattcgccaatttgcccaatcaggtgtaccgcaaggccgtcaag
cgtggctttgagttctccctgatggtggtgggtggcagtggtttgggcaaatcaacgctg
atcaattccatgttcttgtcggacatctacaatgccgaacagtatccgggaccatcgttg
cggaagaagaagacagtcgccgttgaggccaccaaggtgatgctcaaggagaacggcgtt
aatctaacgctaactgttgtggacacacccggattcggtgatgctgtggacaacagcaat
tgctgggtgcccattctggagtatgtggacagcaaatatgaggagtatttgacggcggag
tcgcgtgtctatcgcaagagcatctcggataatcgggtgcactgctgtttgtatttcata
gcgccatcgggtcacggtctgttgccattggacattgcgtgcatgcagagcttgtcggat
aaggtgaatctggtgccggtgattgcgaaggccgacaccatgacaccggacgaggtgcat
ctgttcaagaaacagattctgaatgagattgctcagcataagattaagatttatgatttt
cccgccacactcgaggatgccgccgaggagtccaaggccacacagaatcttcgcagtcga
gtgccatttgctgtcgttggcgccaacaccatcatcgagctggatggcaagaaggtgcgt
ggacgtcgttatccttggggcattgtcgaggtggagaatttgacgcattgcgattttatt
gcattgaggaatatggtaatacgcacccatctacaggatctgaaggatgtgacgaacaat
gtccactatgagaactatcgatgtcgcaagctatccgaattgggactggtcgatggcaag
gcgcgactctccaacaagaatccgctaacccaaatggaggaggagaagcgcgagcatgag
cagaagatgaagaaaatggaggccgaaatggagcaggtgttcgacatgaaggtcaaggag
aagatgcaaaagctgaaggactccgaactggagatggcccgtcgtcacgaggagcgcaaa
aaggcattggaactccagatccatgagctcgatgagaagcggcgcgaatttgagcgggag
aaaaaggaatgggaggatgtgaatcatgtgacgctcgaggagctcaagcgacgcagtctt
ggcggcaatagtagcaccgacaatgtcgatggcaagaaggagaagaagaagaaaggtctg
ttctaa

DBGET integrated database retrieval system