KEGG   Drosophila grimshawi: Dgri_GH21422Help
Entry
Dgri_GH21422      CDS       T01061                                 

Definition
(RefSeq) GH21422 gene product from transcript GH21422-RA
  KO
K00026  malate dehydrogenase [EC:1.1.1.37]
Organism
dgr  Drosophila grimshawi
Pathway
dgr00020  Citrate cycle (TCA cycle)
dgr00270  Cysteine and methionine metabolism
dgr00620  Pyruvate metabolism
dgr00630  Glyoxylate and dicarboxylate metabolism
dgr01100  Metabolic pathways
dgr01200  Carbon metabolism
Module
dgr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dgr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dgri_GH21422
   00620 Pyruvate metabolism
    Dgri_GH21422
   00630 Glyoxylate and dicarboxylate metabolism
    Dgri_GH21422
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Dgri_GH21422
Enzymes [BR:dgr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     Dgri_GH21422
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N THF_DHG_CYH_C Glyco_hydro_4 Semialdhyde_dh
Motif
Other DBs
NCBI-GeneID: 6559963
NCBI-ProteinID: XP_001986540
FlyBase: FBgn0128884
UniProt: B4J9C6
AA seq 331 aa AA seqDB search
MISMKIGQIARYSRCAKKAVKVAVVGAAGGIGQPLSLLLKMSPMISTLALHDLQDIKGVV
ADLSHICTGTRVQAFVGAKELQCALEDAAIVVVPAGLPRKPGMNRADLLTVNGDVAVEVA
KTIAFVCPKALMAFITNPINTIIPIVAQILKERNVFDPNRLFGVTTLDVVRARTFVAEAL
CIDPRTVQIPVIGGHAGITILPLLSQCLPKYTVTGAERDKLVKRIQDAGNEVVEAKAGAG
SATLSMAFAAAKFVDCLLRAINGEENVIACSYVQSKVTEAEFFATPILLGPGGIYKNLGL
PQLDEQEKKAVETLVKQLQQDIAEGAKFLCK
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgatatcgatgaagattggccagatcgcccgctacagcagatgcgctaagaaggctgtc
aaggtagccgttgtgggtgccgctggtggcattggacagccgctctcgctgctcctcaaa
atgagtccgatgatttcgacgctggcgctgcatgatttgcaggatatcaagggtgttgtc
gctgatctctcgcacatatgcactgggacccgggtgcaggcgtttgtgggcgccaaggag
ctgcagtgcgcattggaggatgctgccattgtggtcgtcccagcgggattgccacgcaaa
ccgggcatgaatcgtgccgatcttttgactgtcaatggcgatgttgccgtcgaagtggcc
aaaacaattgccttcgtctgtccgaaagctctcatggcctttatcacgaatccaatcaac
acgattatacccatcgttgcccagatactcaaggaacggaatgtcttcgatccgaaccga
ctatttggcgtcaccaccctggatgttgtacgcgcccgaacatttgttgcggaagccttg
tgcattgatccgaggactgtgcagatacccgtcattggtggacatgctggcattacaata
ttgccacttttatcccagtgtctgcccaagtatacagtgactggcgcggaacgggataag
ttggtgaaacgcattcaggatgcgggcaacgaggtggtcgaggcgaaggctggcgcggga
tctgccacactttcgatggcctttgctgctgctaaatttgttgactgcctgctgcgtgcc
atcaatggtgaggagaatgtcatcgcctgctcctatgtccagtcgaaggtgaccgaggcg
gaattctttgccacgcccattctactgggaccgggcggcatttacaagaatctgggactg
ccccagctggatgagcaggagaagaaagccgtcgaaacactcgtcaaacagctccagcag
gatatcgcagaaggcgccaagtttctatgcaaataa

DBGET integrated database retrieval system