KEGG   Drosophila grimshawi: Dgri_GH21773Help
Entry
Dgri_GH21773      CDS       T01061                                 

Definition
(RefSeq) GH21773 gene product from transcript GH21773-RA
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
dgr  Drosophila grimshawi
Pathway
dgr00340  Histidine metabolism
dgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Dgri_GH21773
Enzymes [BR:dgr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     Dgri_GH21773
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC SepSecS Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 6561303
NCBI-ProteinID: XP_001987175
FlyBase: FBgn0129234
UniProt: B4J6W1
AA seq 816 aa AA seqDB search
MDFQEYRQRGKEMVDYIADYLENIRERRVFPDVSPGYMRQLLPESAPVEGESWQKIFGDI
EPIIMTGVTHWQSPHMHGYFPALNSMPSLLGDMLADAINCLGFTWASSPACTELEIVVMN
WLGKMIGLPDEFLHLSNNCQGGGVLQTTASEATLVCLLAGRTRAIQRFHEHHSGYQDAEI
NARLVAYCSDQAHSSVEKAALIGLVRMRYIEADEDLAMRGKPLRDAIEDDIKQGLVPFWV
CATLGSTGSCSFDNLDEIGIVCREYNLWLHVDAAYAGSAFICPEFRTWLRGIERADSIAF
NPSKWLMVHFDATAMWVRDSTAVHRTFNVEPLYLQHENSGVAVDFMHWQIPLSRRFRALK
VWFVLRSFGIKGLQRHIREGVRLAQKFEALVLADHRFELPAKRHLGLVVFRIRGDNEITE
RLLKRLNYRGNQHCVPSSLKGQYVIRFTITSAQTTLDDIVKDWMEIRQVASMVLDEMNIT
IANRVYLKDTKEKSEAFGSSLLLSNSPSSPKVVNGSFAAIFDADEFLAKTYAGIRIAHQE
SPSTRRRVRGILMSGKQFSLDSHIDVVAVVRNITNQGESVAGQGETRAQASISEDVDNEE
SAAEETELLQLTNLNSNTRSHSQSNSNTNSNSNIQNHNHNHNLNASTPANHFRPITLLTS
ASPSSSPSPSDNSRDVDVSVDIYHGKKFLEPVSSLVENSSFTSSICRMPTPMTTPTEPQP
PPGDFGDDDWPAKTLSQLLLERYANSSSSTDSSSISLARAATPTLSRLSSLNELASPLLG
SFAASQSQPLHSALGASRLSDSDATICSAASSLESL
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atggactttcaggaatatcggcaaaggggcaaggagatggtcgattatatcgctgactat
ttggagaatatacgcgagcgccgcgtcttccccgatgtgagtcccggctatatgcgtcag
ctgctgccggagtcggccccagttgagggcgagtcgtggcaaaagatatttggcgatatc
gagccgattataatgaccggcgtgactcattggcagtcaccgcatatgcacggctatttt
ccggccctcaactcgatgccatcgctgctgggcgatatgctggcggatgcaatcaattgt
ttgggcttcacctgggccagttcgccggcttgcaccgaactggaaatcgttgtgatgaac
tggctgggcaagatgattgggctgcccgatgagtttctccatttgagcaacaattgccag
ggcggcggcgttttgcagaccacggccagcgaggcgacacttgtctgcctgctcgccgga
cgaacgcgggccatccagcgtttccatgagcatcactctggctatcaggatgccgaaata
aatgcccgcctcgtggcctattgctcggatcaggcgcactcgagcgtggagaaggcggca
ctcattggactcgtgcgtatgcgctacattgaggctgacgaggacttggccatgcggggc
aaaccgttgcgcgacgccatcgaggacgacattaagcagggcctggtcccattctgggtg
tgtgccacactcggctccacgggcagctgcagcttcgacaatctggatgagatcggcatc
gtgtgcagggagtacaacctgtggctgcatgtggatgctgcctatgccggcagcgccttc
atctgtcccgagtttcgcacctggctgcgtggcatcgagcgagccgattcgatcgccttc
aatccctccaagtggctgatggtgcactttgatgccactgcgatgtgggtgcgtgacagc
accgcggtgcatcgcaccttcaatgtggagccgctgtatctgcagcacgagaactccggc
gtggccgtcgactttatgcactggcaaataccgctgagtcgtcgcttccgtgcgctcaag
gtgtggtttgtgctccgatcctttggcatcaagggcttgcagcgccacatccgggagggt
gtccgtctggcgcagaagtttgaggctctggtgctggccgatcatcggttcgagttgccg
gccaagcggcatctgggtctggttgtcttccggatacgcggcgacaatgagatcaccgag
cggctgctgaagcgtttgaactatcggggcaatcagcactgtgtgccctcctcgctgaag
ggacagtatgttatccggttcacgatcacctcggcacagacaacgctcgatgatattgtc
aaggattggatggaaattaggcaggtggcaagcatggtcctcgacgagatgaacatcaca
attgcgaatcgcgtctatctgaaggatacgaaggagaagagcgaagcctttggctctagt
ttgctgctatcgaattcgccatcgtcgccgaaggtggtcaatggctcctttgcggccatt
ttcgatgccgacgagtttctggccaagacctatgctggcatacgcatagcgcaccaggaa
tcgccgtcgacacgtcgccgagtgcgtggcatactcatgtccggcaaacagttctcgctg
gactcgcacattgatgtggtggctgtggtgcgcaacatcaccaaccagggtgaatctgtt
gccggacagggggaaactcgcgctcaggcgagcatcagcgaggatgtggacaacgaggag
tccgccgcggaagaaactgagctgctgcagctgaccaacctcaactcgaatacccgttct
cattcccaatccaactccaacacaaactccaactcgaatatccagaatcataatcacaat
cacaatctgaacgcctccacgccagccaatcactttcgacccattacattgctcacgtcg
gcatcgccatcgtcatcgccatcgccgtcggacaacagtcgggatgtggatgtcagtgtg
gacatttatcatggcaagaaatttttggagcccgttagcagcctcgtcgagaacagttcc
tttaccagcagcatttgccgtatgcccacgcccatgacgacgcccacagagccacagccg
ccaccaggtgacttcggggacgacgactggccagcgaagaccctaagccagctgctgctg
gagcgttacgccaactcctcctcgtcgacggacagcagcagcattagtctggccagagct
gccacgcccacactgagcaggctaagcagcctcaatgaattggcctccccgctgctcggc
tcctttgccgcatcccaatcacagccgctgcactcggccctgggcgcatcgagactcagt
gactcggatgcgaccatctgttcggctgcctcatcgctggagtccctataa

DBGET integrated database retrieval system