KEGG   Drosophila grimshawi: Dgri_GH23545Help
Entry
Dgri_GH23545      CDS       T01061                                 

Definition
(RefSeq) GH23545 gene product from transcript GH23545-RA
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
dgr  Drosophila grimshawi
Pathway
dgr00052  Galactose metabolism
dgr00511  Other glycan degradation
dgr00531  Glycosaminoglycan degradation
dgr00600  Sphingolipid metabolism
dgr00604  Glycosphingolipid biosynthesis - ganglio series
dgr01100  Metabolic pathways
dgr04142  Lysosome
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dgri_GH23545
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dgri_GH23545
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Dgri_GH23545
   00604 Glycosphingolipid biosynthesis - ganglio series
    Dgri_GH23545
   00511 Other glycan degradation
    Dgri_GH23545
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dgri_GH23545
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Dgri_GH23545
Exosome [BR:dgr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dgri_GH23545
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5 Cellulase
Motif
Other DBs
NCBI-GeneID: 6568003
NCBI-ProteinID: XP_001994229
FlyBase: FBgn0131002
UniProt: B4JT75
AA seq 639 aa AA seqDB search
MHFISCFVTILTFTLVAGTESTNRNFTVDYENDRFLKDGQPFRFISGSFHYFRAHPETWS
RHLRTMRAAGLNAVTTYVEWSLHNPRDGVYVWTGIADLERFIRLAVDEDLLVILRPGPYI
CAERDMGGFPYWLLKKYPGIQLRTADINYLSEVRIWYAQLMVRMSPFLYGNGGPIIMVQV
ENEYGSYFACDVNYRNWLRDETQSHVNGKAVLFTNDGPSVLRCGKIQGVLATMDFGATSN
LKDTWARLRRFEPKGPLVNAEYYPGWLTHWTEPMANVSTDSITGTFIDMLESGASVNFYM
FYGGTNFGFTAGANDNNPGKYIADITSYDYDAPMTEAGDPTPKYMALRRIISRYLPLPDV
PVPMPVPKRAYGKVRLVSCCTLLSADGRQTLGTGVVRAAKPQTFEALDQYSGLVLYEAWL
PAHFKRDPSVLYVNGLADRGYVYVDNEFVGILARETPIYELPLSASSGRQLQILVENQGR
LNYGVQLNDFKGLTKDVRLDKQVLTNWNMTKYPLESYDDLEKLIAQSTEAASIGFQELRW
PSTMLRSGPAIYHGSLSIDSADQLADTYLDMSDWGKGIVFLNGENLGRYWPLVGPQITLY
VPAPVLKVGNNRLIVVEYQQAPTSMELEFRDTPILNGRS
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgcatttcatcagttgttttgtgacaatcttgacgttcaccttagttgctggaactgag
agcactaatcgcaactttactgtggattatgagaatgatcgatttctaaaggatggacag
ccatttcgctttatatccggctcgtttcactactttcgcgcacatcctgaaacctggtcc
cgacacctgaggacaatgcgtgccgctggcctcaatgcagttacaacatacgtggaatgg
tcactgcacaatccgcgcgatggcgtctacgtttggacgggcattgcggatctggagcgc
ttcatccgcctggcggtggatgaggatttgttggtgatactgcgtccgggtccttacata
tgcgctgagcgcgatatgggtggttttccctactggctactcaaaaagtatccaggcatc
caactgcgcacagccgacataaactatctcagcgaggtgcgcatctggtatgcccagcta
atggttcgcatgtcaccctttttgtatggcaatggaggacccatcatcatggttcaggtc
gagaacgagtacggctcctacttcgcctgcgacgtgaactatcgcaactggttacgcgac
gagacccagagccatgtgaatggtaaggcagtgctgtttaccaacgatggaccctctgtg
ctgcgttgcggcaagattcagggtgttttggccacaatggactttggcgccacctcaaac
cttaaggacacctgggcaaggctgcgacgcttcgagcccaaaggtccattggttaatgcc
gaatactatcccggctggctgacgcactggacagaaccaatggccaacgtgagcacagac
tcaataacgggcacatttattgatatgctggagagtggagccagtgtcaatttttatatg
ttctatggcggcaccaattttggttttacggcgggcgccaatgacaacaaccccggtaaa
tatatagcggacatcaccagctacgactatgatgcaccaatgactgaagctggtgatcca
acgccaaaatacatggcactgcgtcgaataataagcagatatttgccattgccggatgtg
ccggtgccgatgccagtgccgaagcgagcttacggcaaagtgcgattggtcagctgttgc
acgctgctctccgcggatggacggcagacactcggcacgggcgttgtgcgtgccgccaag
ccacagacctttgaggcactggaccaatattccggactggtgttgtatgaagcctggctg
ccggcgcacttcaaacgggatccgagcgtgttgtacgtgaacggcttggcggatcgcggc
tatgtctatgtggacaatgaatttgtgggcatactggcgcgtgagacgcctatctatgag
ttgccgctgagtgccagctcgggtcgccaattgcagatacttgttgagaatcagggacgc
ctcaactatggggtgcagttgaacgacttcaagggcctcacgaaagatgtgcgcctggac
aagcaggtactgaccaactggaatatgaccaagtatccactggagtcgtatgatgacctg
gagaaactcatcgcccagtcaacggaggcggcaagcattggtttccaggagctgagatgg
ccaagtacgatgctacgctctggaccagctatctaccatggatctctgagcatcgatagt
gcggatcagctggcggacacatatctggatatgtccgactggggcaagggtatcgtcttc
ttgaatggcgagaacttggggcgatattggcccctggtgggaccgcagataacactctat
gtgcccgcgcccgtgctcaaggtgggcaataaccgcttaatcgtggtggaatatcaacag
gcgcccacatcaatggagctggagtttcgggatacacccattcttaatggcagatcttaa

DBGET integrated database retrieval system