KEGG   Drosophila grimshawi: Dgri_GH23962Help
Entry
Dgri_GH23962      CDS       T01061                                 

Definition
(RefSeq) GH23962 gene product from transcript GH23962-RA
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
dgr  Drosophila grimshawi
Pathway
dgr00020  Citrate cycle (TCA cycle)
dgr00640  Propanoate metabolism
dgr01100  Metabolic pathways
dgr01200  Carbon metabolism
Module
dgr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dgr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dgri_GH23962
   00640 Propanoate metabolism
    Dgri_GH23962
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dgr04147]
    Dgri_GH23962
Enzymes [BR:dgr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     Dgri_GH23962
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Dgri_GH23962
Exosome [BR:dgr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dgri_GH23962
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-GeneID: 6567958
NCBI-ProteinID: XP_001994347
FlyBase: FBgn0131419
UniProt: B4JTJ3
AA seq 451 aa AA seqDB search
MASFLARAGGCLIETVKPATVAKILNYSPIGLQQIRNLNVQEHVSYTLLNESNIPTPRFA
VAKNGKEAHDIAQNLKTDNLVLKAQVLAGGRGKGTFKNGLKGGVRVVFDADSAEQYSSKM
IDQLLVTKQTGAAGRICKKVMVAERKFPRREFYFAVMMERAFNGPVLIASKEGGVDIEEV
AKENPDAILYEPIDIVEGLTKEQACRMIEKVGLGGAGADEHIEMLMNLYKLFVKKDALLV
EINPYAEDAMTGFFALDAKLRFDDNAEFRQKELFCMRDWTQEDPKEVEAAKYNLNYIALD
GTIGCMVNGAGLAMATMDIIKLYGGEPANFLDVGGGATAEAVKAAFKIITSDKKVMCLLV
NIFGGIMRCDVIAEGIIAAAKDLNLNLPIVVRLQGTKVKEARELIRSSGLKILARDDLDK
AADMAVHLAQIVSLAREMNMDVNFEIPDAQK
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctttttggcacgtgcaggcggctgcctcatcgaaactgtgaaacccgcgact
gttgcaaagatcctgaattactcgccaattggactgcagcaaataagaaatcttaatgtg
caggaacacgtctcatacaccctgctcaacgaaagcaacatcccaacgcctcgatttgcc
gttgccaagaatggcaaggaggctcatgatattgcccaaaacctgaaaacagataatctg
gtgctgaaggcgcaagttcttgctggcggtcgcggcaagggaacattcaagaacggcctg
aagggcggtgtgcgcgtcgttttcgatgccgacagcgctgagcaatattcatccaagatg
attgatcagctgctggtgaccaagcaaactggcgccgctggtcgcatctgtaagaaggtg
atggttgccgagcgcaaattcccacgtcgtgagttctactttgccgtcatgatggagcgc
gccttcaacggtccggttttgattgcatccaaggagggcggcgttgacattgaggaagtt
gccaaggaaaatcccgatgccattctttatgagcccatcgacattgtcgagggtcttacc
aaggagcaggcctgcagaatgattgaaaaggtcggactgggtggagccggtgctgatgag
catatcgaaatgctgatgaatctgtacaaactgtttgtgaagaaagatgcgctcttggtt
gaaatcaatccctatgccgaagatgccatgaccggcttctttgcccttgatgccaaattg
cgtttcgatgacaatgccgagttccggcagaaggaactgttttgcatgcgcgactggact
caggaagatcccaaggaggtcgaggcggccaaatacaatttgaattacattgccctggat
ggtaccattggttgcatggttaacggtgctggtctggccatggccaccatggatattatc
aagttgtacggcggtgagccagccaatttccttgacgtcggcggtggcgccacggcagaa
gccgtcaaagctgcattcaagattattacatcggacaagaaagtcatgtgcttgttggtc
aacattttcggtggcattatgcgctgcgatgtcattgccgagggcatcattgctgccgca
aaggacttgaacctgaatttgccaatcgttgtgcgtttgcagggcaccaaggtgaaggag
gctcgcgagctgatacgttcatcgggcttgaagatcttggcgcgcgatgatttggacaag
gctgctgatatggccgtgcatttggcacagattgtttcgctggcgcgcgaaatgaacatg
gatgttaactttgagattcccgatgcacagaagtag

DBGET integrated database retrieval system