KEGG   Drosophila grimshawi: Dgri_GH24313Help
Entry
Dgri_GH24313      CDS       T01061                                 

Definition
(RefSeq) GH24313 gene product from transcript GH24313-RA
  KO
K02260  cytochrome c oxidase assembly protein subunit 17
Organism
dgr  Drosophila grimshawi
Pathway
dgr00190  Oxidative phosphorylation
dgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Dgri_GH24313
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dgr03029]
    Dgri_GH24313
Mitochondrial biogenesis [BR:dgr03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    Dgri_GH24313
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX17
Motif
Other DBs
NCBI-GeneID: 6565907
NCBI-ProteinID: XP_001992237
FlyBase: FBgn0131769
UniProt: B4JMK1
AA seq 77 aa AA seqDB search
MGSNSSKGVEVVATAAAPASKATDAAAAGDKPKCKACCACPETKRARDQCIMENGEENCT
KLIEAHKKCMRDSGFNI
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
atgggcagtaattcgtcgaagggagtcgaagtcgttgcgaccgcagcagcaccagcgtcc
aaggccacagatgccgccgccgccggcgacaagcccaaatgcaaagcctgctgcgcctgt
cctgaaaccaaacgtgcacgtgaccaatgtattatggagaacggcgaggagaactgcaca
aagctgattgaggcgcacaaaaaatgcatgcgcgattcgggcttcaatatctaa

DBGET integrated database retrieval system