KEGG   Drosophila grimshawi: Dgri_GH24824Help
Entry
Dgri_GH24824      CDS       T01061                                 

Definition
(RefSeq) GH24824 gene product from transcript GH24824-RA
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
dgr  Drosophila grimshawi
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dgr01001]
    Dgri_GH24824
Enzymes [BR:dgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dgri_GH24824
Protein kinases [BR:dgr01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   Dgri_GH24824
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 6565865
NCBI-ProteinID: XP_001992567
FlyBase: FBgn0132279
UniProt: B4JNI1
AA seq 354 aa AA seqDB search
MLSLQNQRQPKTSPLVDDYEISDTVLGLGINGKVVQCTNRRTRHNYALKVLLDNEKARRE
VDLHWRASGCKHIVNIIDVYENTYSGRKCLLVVMECMEGGELFQRIQDKAESSFTEREAA
HIMREICEAIYYLHSRDIAHRDLKPENLLYTTTQPNAVLKLTDFGFAKETFTNDTLQTPC
YTPYYVAPEVLGPQKYDKSCDIWSLGVVMYIIMCGFPPFYSINGLSISPGMKKRIRSGQY
DFPDPEWTNVSQAAKDLIKGMLNVDPSKRLCIEDVLRNKWIAQYNAVPQTPLCTGRMLKE
GEETWPEVQEEMTRSLATMRVDYDQVSNAQLASDNQHSETTSKNLSDQVFAQNA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgctttcgctacagaatcaaaggcaacctaaaacgtcgcccctggtggatgactatgaa
atatcggacactgtccttggactgggcatcaacggtaaagtagtgcagtgcaccaatcgt
cgcactagacacaactacgccctcaaagtgctcctcgataatgagaaggccagacgcgag
gtcgacttacactggcgggcaagtggctgcaaacacatcgtgaacatcatcgatgtctac
gagaatacctacagcggtcgcaagtgtctcctggtcgtaatggagtgcatggagggcggt
gagttgttccagcgcatacaagacaaggcggagagctcgttcacggaacgagaggcagct
catataatgcgcgagatttgcgaagcgatttattatctgcacagtcgcgatattgcgcat
cgcgatttaaagccggagaacttgctctatacgacaacgcagccgaatgcggtgcttaag
ctcaccgatttcggtttcgccaaggagaccttcaccaatgacaccctacagacgccctgc
tatacgccctactatgtcgcgccggaggtgctcggtccgcaaaagtatgacaaaagctgc
gacatctggtcactgggcgtggtcatgtacattatcatgtgcggctttccgccgttctac
agcatcaacggtctatcgatatcgccgggaatgaagaaacgcatacgctccggccaatat
gatttccccgacccggaatggacgaatgttagccaggcggccaaggatctaatcaagggc
atgctcaacgtggatcccagcaagcgtttgtgcatcgaggatgtgctgcgcaacaagtgg
atcgcccaatataatgcagtaccacaaacaccgctctgcaccggccgaatgctcaaggag
ggcgaggagacctggccggaggttcaggaggaaatgacacgttcactggcaaccatgcgt
gtggactacgatcaagtaagtaatgcgcagctcgcaagtgacaaccaacattccgaaaca
acttcaaaaaatctgtcggatcaagttttcgcccaaaacgcttaa

DBGET integrated database retrieval system