KEGG   Drosophila grimshawi: Dgri_GH24977Help
Entry
Dgri_GH24977      CDS       T01061                                 

Definition
(RefSeq) GH24977 gene product from transcript GH24977-RA
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
dgr  Drosophila grimshawi
Pathway
dgr00010  Glycolysis / Gluconeogenesis
dgr00562  Inositol phosphate metabolism
dgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dgri_GH24977
   00562 Inositol phosphate metabolism
    Dgri_GH24977
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     Dgri_GH24977
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     Dgri_GH24977
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 Neurokinin_B
Motif
Other DBs
NCBI-GeneID: 6571605
NCBI-ProteinID: XP_001997789
FlyBase: FBgn0132432
UniProt: B4K3D5
AA seq 465 aa AA seqDB search
MRLLLLLTALLALQLVGGQDDYCFGKDAEREQTRHFTSKTAYQIVKGTNMDKQYQVPGCE
PKKMWIFHRHGTRLPTPNTIRAAPRLEDLRDQIVKNYRVLRTKPETNALCSTDLIAIQMW
KWNTSITVDIEEHLTTQGYEDLRGTAKVYQHYYPTVLPTRYNDSYYLFRHTDTQRTTESF
KGFTEGLFGDNTVATAADIPEQDLLLRPYDYCNDFKDKNYKGEGSEYQKYRTSAIWNRTV
DDITKRLGFTFLAEEDIELMYDMCRYEQAWQVDRTSVWCGAFLPEQVTVLEYAEDLKYYY
GSGYGFEENTKFNCRAVQDMLTRLSSPVSPHVIAYFAHSTGLQTLLTALGINKDDVALRA
DNYNSMTSRRWKTSLLGPFAGNFVAVKYECTEALEKEKVVFFLNQNAVELDWCNVGLCDW
SQVLEHYKTISEANCDEYYCRSGAMAGRASLLFTALIAAIVYLMH
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgctgctcctgttgacggcgctgctggcgttgcagctggttggtggccaggat
gattattgctttggcaaggatgcggagcgggagcagacgcgtcacttcacctcaaaaaca
gcctatcagattgtcaagggcaccaacatggacaaacagtaccaggtgccaggctgtgag
cccaaaaagatgtggatctttcacaggcacggcactcgactgccaacaccaaacaccatc
cgggcagcacctcgattggaggacctaagggatcaaattgtgaaaaactatcgtgtgctg
cgcacaaagccagagacgaatgctttgtgctcgactgatttgatagccatccagatgtgg
aagtggaacacaagtatcacagtcgatatcgaggagcatctgaccacccaaggctacgag
gatctgcgcggcactgccaaagtctatcagcactactatcccacagtgctgcccaccaga
tacaacgattcctactacctgttccgtcacacggatacccagcgcaccacagagagcttt
aaaggcttcacggagggtctgtttggagacaacacagtggcaactgctgcggatattccc
gagcaggatttgctgttgcggccctacgattactgcaatgacttcaaggacaagaactac
aagggcgagggttccgagtatcaaaagtatcgcacgagcgccatttggaatcgcaccgtg
gatgatattacgaaaagacttggtttcacgtttttggctgaggaagatattgagcttatg
tacgatatgtgccgctatgagcaggcctggcaggtggatcgcaccagtgtctggtgcggc
gcctttctgccggagcaggtgactgtgctggaatacgccgaggatctgaaatactattac
ggatcgggctatggcttcgaggagaacacaaaattcaattgtcgtgccgtgcaggatatg
ctgacaagactgagcagtcccgtctccccgcatgtgatcgcctattttgcgcactcgacg
ggtttgcagacgctgctcacggcgctgggcatcaataaggatgatgttgcactgcgtgca
gataattacaattcgatgacaagtcgtcgttggaagaccagtttgctgggtccatttgct
ggcaattttgtggccgtcaaatatgagtgcacagaggcgctggagaaggagaaggttgtc
ttcttcctcaatcagaatgccgtggagctggactggtgcaacgtgggtctgtgcgattgg
tcgcaggtcctggagcattacaaaaccatctcggaggccaactgtgatgagtactattgc
cggtcgggggcaatggctggacgtgcctcgttgctgtttaccgctttgatcgctgccatt
gtctacttaatgcactag

DBGET integrated database retrieval system