KEGG   Dendronephthya gigantea (soft corals): 114516821Help
Entry
114516821         CDS       T06112                                 

Definition
(RefSeq) GPI transamidase component PIG-T-like
  KO
K05292  GPI-anchor transamidase subunit T
Organism
dgt  Dendronephthya gigantea (soft corals)
Pathway
dgt00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
dgt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgt00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    114516821
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 114516821
NCBI-ProteinID: XP_028392208
Position
Unknown
AA seq 594 aa AA seqDB search
MASIWWHGCFICLLTSLVVGREEFHEELYIKPFPSGDVLTYFQFTTLWSEDIRDKNSFSH
YNLFPKSLGQIVTKYSVEELHLSLTQGFWNAYLWDNAMQPASPGAELAVWFQDKVLLRVD
KEWSGLTNALSGQFCASLNFIKPENTASPNISFRRRGLTSSIYNDSQTLRYASLPGEIVC
TENLTPWKKLLPCNSKSGLSSLLNSLLIYKVKYHSMSIHLRTICEDADCQLPLLELQQTM
SIVTDPVVRSGSNDWSLRKLFGHPLRSSCPLATTSQVFIDVTENDTDNNFSLKPKPTRFI
SKSDEELNRQFAVYNLKGTGKVPKLLTSDSGFNPTLKWQKRSKQAKPPSFFVHRFLTGYG
EEHAGIQCEMRNHHKMASIKIVYFQILPWHFRVYLHTLRVRINDVNIKPEYIDFVPSRDR
ERPTKLEIVLTVPPDSIVTVKMEFDRVFLKWTEHPPDAHHGFYLPSGVITAKLVPNGDSN
RSGLSTDYGSLLSQSLQSTKTDDNLIRIYTEVLLVSLPTPDFSMPYNVICLTCTVVAIAF
GSLYNLSTKRLQEVPPGEPTTLLGKIKQKLSRLKERIIPSTKSGNKPKKEKKND
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcctccatttggtggcatggttgctttatatgccttttaacatcgcttgttgtggga
agggaagagtttcacgaggaattatacattaagccgtttccaagcggtgatgtattaact
tattttcagttcacgactttgtggagtgaagatattcgtgataaaaattcattttcacat
tataatctatttccaaagtcattgggtcaaattgtaacaaaatactctgtagaggagttg
cacttatcattaacacaaggattttggaatgcatacttatgggataatgcaatgcaacct
gcctcacctggggcagaacttgctgtttggtttcaagacaaagttctgctaagggttgat
aaagaatggagtggccttacaaatgctctatctggtcagttttgtgcttcattaaatttc
atcaaaccagagaatactgcatctccaaacatatcatttcgaagacgtggactgacatct
tccatatataatgattcccaaacattgcgatatgcatctttgcctggggaaattgtttgc
actgaaaatttaacaccttggaagaaattactgccttgcaattccaagtctggattatca
agcttactgaactctttgctcatatacaaagtgaaataccactccatgtccatacacctt
cgaacaatatgtgaggatgctgattgtcaacttccattattggagttacaacaaactatg
tccattgtaacggatccagtagtgagaagtggcagtaatgattggtcgcttcgcaaatta
tttggccatcctttgaggtcgtcctgtcctttagcaactacgagtcaagttttcatagat
gttactgaaaacgatactgacaataacttttcattgaaaccaaaaccaacacgttttatc
tcaaaatcagatgaagaactaaaccgacagttcgcagtttacaacttgaaaggaacaggc
aaagttcccaaattgcttacctctgatagcggatttaatccaacactgaaatggcaaaaa
aggtctaaacaagcgaaaccgccgtctttctttgtccatcgttttttgacaggttatgga
gaagaacatgctggaatacagtgtgagatgagaaatcaccacaagatggcgtctatcaag
atcgtttatttccaaatactaccctggcatttcagggtatatctgcatacgttacgtgtt
cgcataaacgatgtgaatattaaaccagaatatatcgattttgtgccctccagagatcgt
gagaggccaacaaaattggagatcgttctgactgtgcctccagattcaattgtgactgta
aaaatggagttcgatcgagtttttttgaagtggacagaacatccacctgacgcacatcat
ggattctatttaccgtcgggtgttattacagctaaattagtaccaaatggagactcgaac
agatcaggactttcaacagactatggatcgcttctgtcacagtcattacaaagtaccaaa
actgatgacaatttaattcgaatctacacggaagtcctacttgtatccttgcctactcct
gattttagcatgccttataacgtaatctgtttaacttgcaccgtcgtggccattgctttt
ggctcattatacaacctgtccacaaaacgtttgcaagaagttcctccgggagaaccaacc
acattgcttggtaaaatcaagcaaaaactatctcggctcaaggagagaataattccttcc
acaaaatcgggaaataaaccgaagaaggagaagaaaaatgattag

DBGET integrated database retrieval system