KEGG   Dendronephthya gigantea (soft corals): 114520713Help
Entry
114520713         CDS       T06112                                 

Definition
(RefSeq) ethanolamine-phosphate cytidylyltransferase-like isoform X1
  KO
K00967  ethanolamine-phosphate cytidylyltransferase [EC:2.7.7.14]
Organism
dgt  Dendronephthya gigantea (soft corals)
Pathway
dgt00440  Phosphonate and phosphinate metabolism
dgt00564  Glycerophospholipid metabolism
dgt01100  Metabolic pathways
Module
dgt_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:dgt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    114520713
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    114520713
Enzymes [BR:dgt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.14  ethanolamine-phosphate cytidylyltransferase
     114520713
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 114520713
NCBI-ProteinID: XP_028396836
Position
Unknown
AA seq 379 aa AA seqDB search
MGNNDARVWANGCFDVFHFGHANFLRQAKVMGSYLIAGVHGDSDIARNKASPVMGERERA
KIISAVKWVDEVRTGVPYGDVLKTLDENACQFCVHGDDIAQDANGRDIYAECKEKGRFCE
CKRTEGISTTLIIDRILLADAGGHKELTHWPHVGGPLSQISKEIENEPEDAQKKNEESEI
LKENDSNGFVQRRLEMPVEYYREKVDEFSSKSRTPERNMKVIYAQGVFDLFHSGHVDFLE
KCKASVEDGFLVVGVLTDEEISRVYGGYPVTNTYERVLALLSCKFVDQVEIGVPYEITSQ
FLEDMKIEYVFHGMLWELPSDPYKAVRDKNIFYQVDSGNDLTTSAIIERIINSREMYRER
NSKKSESQFSRVRLQGNKP
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgggaaataacgatgcccgcgtctgggccaatggctgttttgacgtatttcattttggc
cacgcgaattttctacgccaggcaaaagttatgggaagctatttgatagctggagttcat
ggggactcggatatagcgaggaacaaagcgagtcctgttatgggcgaaagggaacgagcg
aaaatcatctcagccgtgaagtgggtggacgaggttcgcactggtgttccgtacggcgat
gttttgaaaacgctggacgaaaacgcgtgtcagttttgcgtgcacggggacgatatagcg
caggacgcgaatggacgtgatatctacgcggaatgcaaggaaaaaggaagattttgtgag
tgtaaacgcaccgaaggtatttcaacaacgctcataatagataggatattgctcgccgat
gctggtggccataaagaacttacacattggccacacgttggtggacccttatcgcaaata
tcgaaggaaatagaaaatgaaccggaggacgctcagaaaaagaacgaggaatcggaaatc
ctgaaagaaaacgacagcaatggcttcgttcagcgacgtctcgaaatgccagtggagtac
tacagggaaaaagtcgacgaattttcgtcaaaatcgcgaacaccggaacgaaacatgaaa
gtgatctacgcacaaggcgtcttcgatctctttcactcaggacatgttgactttttagag
aagtgcaaagccagcgttgaggacgggttcttggtggtcggagtgttaactgatgaagaa
atatctcgggtgtacgggggatatccggtgactaacacgtacgaacgagttctggccttg
ttgtcctgcaagtttgtggatcaagttgagatcggagtgccttacgaaatcacttcgcag
tttctcgaagacatgaagatcgagtatgtatttcatggtatgctctgggagctgccctct
gacccttacaaggcagtgagagataagaatatcttctatcaagtggacagcggcaacgac
ctcacaactagcgcgatcattgagagaatcattaatagcagggaaatgtacagagaaaga
aattccaaaaaatcagagagtcaattttcaagagttcgcctccaaggaaacaaaccctga

DBGET integrated database retrieval system