KEGG   Dendronephthya gigantea (soft corals): 114521662Help
Entry
114521662         CDS       T06112                                 

Definition
(RefSeq) succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial-like
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
dgt  Dendronephthya gigantea (soft corals)
Pathway
dgt00020  Citrate cycle (TCA cycle)
dgt00640  Propanoate metabolism
dgt01100  Metabolic pathways
dgt01200  Carbon metabolism
Module
dgt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dgt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dgt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    114521662
   00640 Propanoate metabolism
    114521662
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dgt04147]
    114521662
Enzymes [BR:dgt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     114521662
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     114521662
Exosome [BR:dgt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   114521662
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A RimK
Motif
Other DBs
NCBI-GeneID: 114521662
NCBI-ProteinID: XP_028397959
Position
Unknown
AA seq 457 aa AA seqDB search
MVCAIQAHMIVLASFVLVPHFVGTNSKWHKFEVCRISGCRKLLHVSRYLEGRWLRPLSVS
SKCFLDLQEYQSKELMKSHGINVQKFQVADGENDVSELVKQLDVSEVVIKAQVLAGGRGK
GTFSSGLQGGVKLSKNFDEIPSIVDQMIGHSLVTKQTGQDGVVVRKVMLGEALDISRETY
LAILMDRAYEGPVIVASPEGGVDIEEVAEKTPDKIYKFPIDINSGIKREQALELADKLNF
RGLLREEAAAQIEKLYELFIARDATQVEVNPFGETDDGRVVCFDAKINFDDNAKFRQEDL
FASEDISEKNPREVEARKYDLNYIGMDGNIACIVNGAGLAMATMDMIKLHEGEPANFLDL
GGGIQEEGVHQAFKIIISDKNVEAILVNIFGGIVDCKMVAKGIQAAYEKLKIDIPLIVRL
EGRNVVDAKKILKSSGIPVTTAEDLDEAAMKAVSSLV
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggtatgcgcaatccaggcacatatgattgttcttgcctcatttgttttggtgcctcat
tttgtgggaacaaatagcaaatggcacaagtttgaagtttgtcgcatttctggttgcaga
aaactattacacgtatctagatatctagagggacgttggttacgtccactcagtgtgagc
agcaagtgtttccttgatcttcaagaataccaaagtaaagaattaatgaaaagtcatgga
attaatgtgcaaaagtttcaagtagctgatggtgaaaatgatgtatctgaattagttaaa
caattagatgtgagtgaggttgtaatcaaagcacaggtgctggctggagggcgtggtaaa
ggaacattcagcagtggtttacagggtggagttaagcttagtaagaattttgatgaaatt
ccatctattgttgatcagatgattggccattctttagttacaaaacaaactggccaggat
ggtgtagttgttcgaaaggtaatgctaggtgaagcactagacattagtcgtgagacctac
ctggcaattttaatggatcgtgcctatgaaggtcctgtaattgttgctagtcctgaaggt
ggagttgatatagaagaagtggctgaaaaaacccctgataaaatttataaatttccaatt
gatattaattctggaattaagagagaacaagcactggaattagcagataaattaaatttc
agaggactgttaagagaggaagctgcagctcaaattgagaagttgtacgaattattcatc
gctcgcgatgcaactcaagttgaagtaaatccgtttggagaaactgatgatggccgagtc
gtatgctttgatgcaaaaatcaattttgatgacaacgccaagtttcgacaggaagatctg
tttgcaagtgaagacatttccgagaaaaacccgagagaagttgaggcgaggaaatacgac
ttaaattacattggaatggacggcaacattgcatgtatagtaaatggggcaggtcttgcc
atggcaaccatggacatgattaaacttcacgagggtgagccagcgaactttttggacctt
ggtggtggcattcaagaagagggagttcatcaagcgttcaaaataatcatttcggataaa
aatgtggaagcaatacttgtaaatatttttggcggtattgttgattgcaaaatggttgca
aaaggaattcaagctgcttatgaaaaactgaaaattgatattcctttaatcgtgcgattg
gaagggaggaatgtcgtggacgccaaaaaaattctcaagtctagcggtattccagtaaca
accgctgaagatcttgatgaagctgcgatgaaagccgtcagtagtcttgtatga

DBGET integrated database retrieval system