KEGG   Dendronephthya gigantea (soft corals): 114521854Help
Entry
114521854         CDS       T06112                                 

Definition
(RefSeq) cytosolic phospholipase A2-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
dgt  Dendronephthya gigantea (soft corals)
Pathway
dgt00564  Glycerophospholipid metabolism
dgt00565  Ether lipid metabolism
dgt00590  Arachidonic acid metabolism
dgt00592  alpha-Linolenic acid metabolism
dgt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    114521854
   00565 Ether lipid metabolism
    114521854
   00590 Arachidonic acid metabolism
    114521854
   00591 Linoleic acid metabolism
    114521854
   00592 alpha-Linolenic acid metabolism
    114521854
Enzymes [BR:dgt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     114521854
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 114521854
NCBI-ProteinID: XP_028398219
Position
Unknown
AA seq 679 aa AA seqDB search
MERQNVNRFQVKQEKIKVLTVTVVKANRVVVRGFFTKFETPDPYVMLRVHTSPNSRQRTK
VQSDTYNPVWNESFTFYLHHDKKNTLEITMKDEDYGPDDMIGAHELELDDLPMDTEITKI
LHVNKNTTLELKLMIKFDETKELRLSYDLCDEEKAFVQKRKAEILKHMPRILDENTAPRS
IEEVPTIGIMGSGGGYRAVCGLSGVFCALQEAGILDCSSYVTGLSGSSWYISTLYQHEGW
PDSISCQVMAHELKTKFQTGLLSHFHAHFFTQMREKAKRGQLVRLVDLFGLFIGDCLLDN
QESRLSHQSQKVKYGDVALPITTGIRVRLDLPAAEFSEWVEFTPYEYGMAKYGVFGKTSE
FGGKFYKGSLVKKFKESRLSYLQGIWGSAFGIILNTLHDRKNKSESEAEEELKEIAIEEA
KRCKTADDDSDDEDETDGLPEDEIKDGHWLADALNPYNLIASRRGKAAEVFNILRGLQFK
KEEDCDYDEVHGNCKTMCLVDSGIAFNSPYPTLLRPERKVEIILSFDFSQRDGGDTELSF
KNIIKAENWAREHGLPFPQIVGNPVLENPEIQECYVFEDLANPDCPIVLHFPLVNKSFRD
FSAPGVPRVDEESKDFGNFAIFDDPDKPYSSFNFQYTERSFDRLHELMKYNTSANLDIIK
EKIAYRTNFRRNNPYNFCE
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atggaacggcagaacgttaatcgattccaggtaaaacaagagaaaatcaaagtgttgaca
gtgaccgttgtcaaagcaaatcgtgtggttgttagaggattttttaccaaatttgagact
ccagatccttatgtcatgctgagagttcataccagtcctaatagcagacaacggacaaag
gtccagtcagatacttataatcctgtttggaacgaaagttttacattctacttgcatcat
gacaagaaaaacacattagaaattacaatgaaagatgaagattatggtccagatgacatg
attggtgcacatgaacttgagttggatgatttacctatggacactgaaatcacgaaaata
ttgcatgttaacaagaacacaactctcgagctcaagttgatgataaaattcgatgaaaca
aaagaattgagacttagttacgacttatgtgatgaagaaaaggcttttgtacagaagaga
aaagctgaaattttaaaacacatgccaagaattttggatgaaaatacagccccaaggagc
attgaggaggtaccaacaattgggatcatgggatcaggaggtggatatagggctgtatgt
ggattatcaggcgtattttgtgctcttcaagaagctggaatactcgactgttcttcatat
gtaactggattgtcaggctcttcatggtatatttccacattataccaacacgaaggttgg
cctgacagtatatcatgtcaagtcatggctcatgagctgaaaacgaaatttcagacaggt
ttattgagccattttcatgctcacttttttacacaaatgagagaaaaagcaaaacgtggt
caacttgtccgactggttgatttatttgggttgttcattggagattgtttacttgataat
caagagtccagactaagccaccaaagtcaaaaagtgaagtatggtgatgttgccctccca
attacaactggtattcgtgttcgattagatttaccagcagctgaatttagtgaatgggta
gaattcacgccatatgaatatggcatggctaaatatggcgtgttcgggaaaacttcagaa
tttggtggcaaattttacaaaggaagtttggtaaagaaatttaaagaatcccggttgtca
tatttacaaggaatttggggcagtgcgtttggtattattctcaatacattacatgacagg
aaaaacaaatccgaaagtgaagccgaagaggaactaaaggaaatcgcaattgaggaagca
aagcgatgtaaaactgccgatgatgatagtgatgatgaagatgaaacagatggattaccc
gaagacgaaatcaaagatgggcattggttagctgatgcactcaatccttacaatctaatt
gcgtctcgacgaggaaaggccgctgaagtctttaacatattacgaggattgcaatttaag
aaagaagaagactgtgattatgacgaggtacatggcaactgtaagacgatgtgtttggtg
gacagcggcatcgcgttcaattccccttatcccacattactacgtcctgaacgcaaagtc
gaaataatcttgtcgtttgacttcagtcagagagatggcggtgatacagaactatctttt
aaaaacattataaaagctgaaaactgggcaagggaacatggactaccgttcccacaaatc
gtcggaaacccagtccttgaaaatcccgaaattcaagagtgttacgtttttgaggatctg
gcaaatcctgattgcccaatcgtattacattttcctcttgtgaacaaatcatttagggat
ttcagtgctccaggggtaccacgagtggacgaagagagtaaagactttggaaacttcgct
atttttgacgatcctgataaaccttactcttcgtttaatttccaatacactgaaaggagt
tttgacagactccatgaacttatgaagtacaatacttcggcaaatttagacatcatcaaa
gagaagattgcatatcgaaccaatttcagaagaaataatccctacaatttctgtgaataa

DBGET integrated database retrieval system