KEGG   Dendronephthya gigantea (soft corals): 114521913Help
Entry
114521913         CDS       T06112                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 2, mitochondrial-like
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
dgt  Dendronephthya gigantea (soft corals)
Pathway
dgt00071  Fatty acid degradation
dgt01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dgt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    114521913
Enzymes [BR:dgt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     114521913
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 114521913
NCBI-ProteinID: XP_028398287
Position
Unknown
AA seq 666 aa AA seqDB search
MAALFALTRGRCFTPFLAKKTYGCSPILRCLSSHSDDKYIQRSIVPTYHFQPSLPRLPIP
KLEDSCRRYLDAQKVILSPEEYENTKRLVENFKQNEGPELQKELIFKDKQNKHTSYISEP
WTDMYLKDRRSVMLNHNPFMTFKQDSNTDNNHQLVRATNFIISSMKFKNSLDEEILDPEI
FHLNPKKSDTDWFKRVIRFVPSSLSWYGAYLVKAFPLDMSQYTRMFASTRIPQSGRDKLI
TYADSRHILVIHNGNYYTLDVIDEAGTIRPASEILKNLQAIVLDETGDSQYPVAVLTSED
RDSWTSTRQELETLMSNTEPLKMIDSALFVLCLDQDEPETPGEVTKVFLHGDGKNRWFDK
SIQLIVCRNGLSGVHFEHAWGDGVAVLRYFNEIHKDSIDNPACSSSQLASLDLSASTFRK
LEFTLPSGFESKIKAAKENFDERVNSLDMETLQLSTFGREYLKRKKISPDAVMQLAFQMG
YYRQHGKFVGTYESCSTAAFKHGRTETVRPASLATVACSQAFETTHKAGVDEMNNLIQKV
SDYHNQLIKEAAMGQGFDRHFFGLRHLAESSGKVPKIFQDPSYTRLNHIILSTSTLSSPS
VLMGGFAPVVPDGLGIGYSISDHELGCNVLSYGLPTDVGGFLKCVESSLEDLYEVMDGRN
FKNKSG
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atggcagctctttttgctctcacccgtggaagatgtttcacaccctttctggcaaaaaag
acgtatggttgttccccaatcttgcgctgtttgagctctcactctgatgataaatatatt
cagcgcagtattgtgccaacctatcactttcaaccaagcttaccacggttacccatacct
aaactagaagactcttgccgtcgctaccttgatgcacagaaagttatattaagcccagaa
gaatatgaaaataccaaaagacttgtagagaattttaagcagaatgaaggaccagaacta
caaaaggaacttatcttcaaagataaacagaacaaacacactagttacatctcagagccc
tggactgacatgtatcttaaagatcgaagatctgttatgttaaatcataatccatttatg
actttcaaacaagattcaaatactgacaacaaccatcagttggtaagagcaacaaacttc
ataatttcctccatgaaattcaagaattctttagacgaagaaattttagatcctgaaata
tttcacttgaatccaaagaagagtgatactgattggttcaaaagagtaatacgatttgta
ccatcaagcctgtcatggtatggtgcttacttggtgaaggcatttcctttagatatgagt
caatatactcgtatgtttgcgtcaactcggatacctcaatctggcagagataaacttatt
acatatgcagacagcagacatattctagttattcataatggaaattattacacccttgat
gtcattgatgaagcaggaaccatacgcccggcttcagaaatcttaaagaatcttcaagct
atcgtgttggatgagacgggagactctcaatatcctgtggcagttctaacttctgaagat
cgagactcctggacatcaacacgtcaagaactagaaactttgatgagcaacacagaacct
ctgaagatgattgatagtgctttatttgttctctgtcttgatcaagatgagccagagaca
cctggagaggtcacaaaagttttccttcatggtgatggaaaaaacagatggtttgataaa
tcaattcaactgatagtctgtcgtaatggtttgtcaggcgtacacttcgaacatgcctgg
ggtgatggtgttgctgtgttgagatatttcaacgaaatacataaagattccattgataat
ccagcttgttctagttcacagcttgcgtcacttgacttgtctgcttccacattcagaaaa
ctggagttcactcttccctctggttttgaaagtaagataaaagcagcgaaggaaaacttt
gatgaacgcgtaaatagtttggatatggagactttacagttgtccacgtttggtagagaa
tatctgaagagaaagaagatcagtccagatgctgtcatgcagttggcatttcagatgggt
tattaccgtcaacatggcaagtttgttggaacctacgagtcttgtagtacagcggctttc
aaacatggtcgtaccgagactgtgcgaccagcgtcattagccactgtggcctgcagtcag
gcgtttgaaacaacccacaaagcaggtgtggatgaaatgaacaatttaatccaaaaagtg
tcagattatcacaatcaattgattaaagaggcagcgatgggtcaaggttttgatcgtcat
ttcttcggtcttcgtcatcttgccgagtcctcaggaaaggtacctaaaatctttcaagat
ccctcgtacacccgtcttaaccatattattctatccacaagtaccctctcgagtcctagt
gtattgatgggaggttttgcgcccgtggtacctgatggactaggtattgggtatagtatc
tctgatcatgagcttggttgtaatgttttaagttacggtctgccgacggacgttggagga
ttcctcaaatgtgtagaatctagtctcgaagatttatatgaagtgatggatgggcgaaat
tttaaaaataaatctggttga

DBGET integrated database retrieval system