KEGG   Dendronephthya gigantea (soft corals): 114522064Help
Entry
114522064         CDS       T06112                                 

Definition
(RefSeq) exportin-5-like isoform X1
  KO
K14289  exportin-5
Organism
dgt  Dendronephthya gigantea (soft corals)
Pathway
dgt03013  RNA transport
Brite
KEGG Orthology (KO) [BR:dgt00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    114522064
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dgt03016]
    114522064
   03036 Chromosome and associated proteins [BR:dgt03036]
    114522064
Transfer RNA biogenesis [BR:dgt03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    114522064
Chromosome and associated proteins [BR:dgt03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     114522064
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xpo1 IBN_N PQ-loop
Motif
Other DBs
NCBI-GeneID: 114522064
NCBI-ProteinID: XP_028398479
Position
Unknown
AA seq 1247 aa AA seqDB search
MRRGVDKSRKPANVRLFCAMAMLCGKREDIQVVHISQQLAEAVEVILSPNSSQDKRMQAT
RDCEEFKNNKSYLTNCGIYLYSNHANFMVKHFGLQLMHHAVKFNWNEMPEEEKNDLKLLS
LNLTEGCTSSLLDEPSYIKDAIAKFTVEIMKREWPQNWPDVIKTLSEISQKGPSQLFTVL
RTLLFLAEESTKMDGDLPGPRRKDMMSSINIILADLFKFFVKTLQLTAEKMKEMKTQYGN
ITQKHTETKHTEVVIQKTLAESVLVTLCGFVEWVNVKYLVQEEAILLQTLCLLLQEDELR
MRAAECLESIAGRKGPLLERPPLLILFSTDALTLIFSSIRSLVESNDGNSDDENHSFLNR
VCSILSLMGETQLAKLWGAPGCEAVDEPAHFHLYLEALLSLYRHENMLTSETITKTWTSF
LKNKAISTNPTFCSFIPQILEISKTKISRGLQPAINSSKILYPDTDFGSMAEKYNAWTSL
RRSTKDIVQIITSLYPADAFNHAASWLLKLTNTPSSTVTETSAAYYEWDSLTCFAQSVIS
KLFNNDAEYLQELIRCQIRMDNTTIGFYDLAKKCIENLVDYETEALLIKSSIITCLEPFI
PFLQYDFELLIKVIHKIFHSASYQHPNEEDFGHKAFEFRRTAASVWIRLCLSHYKLLINI
LDDLTKHIQMSYDNDSCTSLERSLLAEGLVVISNGYVNFEKQEKYINELLAPIREDWMSP
ELEQALSSPEAFLSFIGLYNSNEDEHITQKRRYTLNMCQRYIHAVLKRIEIPKDSQAQIN
GGFKTRHEDVPRNPGTSSVLPLLSNIFHLNRVFSRIWDPAVRVKIPHHLQPALDIHESEK
AAIFGLDARDGEERPKAEPKRSPVDNMKTFLFKLNEACAMTLADCSRLGEGFYGAPSLGQ
HIVTYVIEPWRYVPNYRLRIFIRGFFKMYCRVCPPSYYESAVVPVVVAALSLMIDHLNKD
WEVVRSREIVRPHLAYIEAPDIDDEEEADKDSEIIENQLVHLLTKNFMEAFFSMCTMKRP
THFESNSPLTTEEPGQVLLKPDCSEDMLEELPQFLLRHPKTCKIFLFLPFVSLQWPDTAG
FVKAAKLCVPFVKQIVKNPPTGVAMSQEMFDQIFTLCLKGLQLMGHHVEIGAQLIRNAVT
IYDILRPLFPSLKDILLQVPNVDPAVVNNYDLTLLSENSHTEKQKRKIFRGLLSGLIGKE
IGKLFQNDITILNLPALPVINKETPSTLADIENPDYGLTRLFEPTKP
NT seq 3744 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgaggagtggacaaaagtaggaaacctgcaaacgttcgccttttttgcgctatg
gcgatgttgtgtggcaagcgagaggatatacaagttgttcatatttcgcagcaattggcc
gaagctgtagaggttatattgagtccgaattcttcccaagacaagcgtatgcaagctaca
agggactgtgaagaattcaagaacaacaaaagctatttaacaaactgcgggatctatctg
tacagcaatcatgcaaattttatggtcaagcattttgggctgcaactcatgcatcatgct
gttaagtttaactggaatgaaatgcctgaggaagaaaagaatgacttgaagttattatca
ttaaacctaactgaagggtgcaccagttcacttctagatgaaccatcctacataaaagat
gcaatagcaaaattcacagttgaaatcatgaagcgagaatggccacaaaactggccagat
gtcatcaaaacactaagtgaaatatcccaaaaagggccctcacaacttttcacagtacta
cggacacttttattcctggcggaggaatcgacaaaaatggatggagatttaccaggtcca
cggagaaaagacatgatgtcctccataaatatcattctggcagatttattcaagtttttt
gtgaagacattgcaacttactgcagagaaaatgaaagaaatgaaaacacaatatggaaac
ataactcaaaaacatacggaaacaaaacatactgaggttgtaattcagaaaactctagcc
gagtcagtcttggtaactctttgcggttttgttgaatgggtgaatgtcaaatacttggtg
caagaagaagcgattttactgcaaacgctctgcctgttgttgcaagaggatgagcttcgg
atgagggccgccgaatgcttagagagcatcgcaggacgaaaggggccactgcttgaacgt
cctcctttgctcatcttgttcagtacggacgcattgacgctgatattctcgtctatcaga
agtctggtcgaaagcaatgacggtaatagcgatgatgaaaaccattcgttcctcaatcga
gtttgtagcattctctctttgatgggagagacacaactcgctaaactctggggcgctcct
gggtgtgaagcagtagacgaaccagctcattttcatctttacttagaagcgttactatcc
ttgtatcgacacgagaacatgctgacttcggagacgataaccaagacatggacaagtttt
ctaaaaaataaagcgatttctacgaatcccacattctgttcttttattccgcaaatcttg
gaaatatcaaaaacaaaaatttcaaggggtctacagcctgcaataaactcaagtaaaata
ttatatccagacacagattttggctcgatggcagagaaatacaacgcgtggacaagtctt
cgaaggagcacaaaagatatcgtacaaatcatcacgtccttgtatccagcagatgctttc
aaccacgctgcgagttggttactgaaactcactaacacaccgtcatcaacagtgacagaa
acaagcgctgcatattatgaatgggacagcttgacctgtttcgcgcaatccgtgataagc
aaattgttcaacaacgatgctgaatacttgcaggagttgattagatgccagattcgaatg
gataacacaacaatcggcttttacgacttagcgaaaaaatgcattgagaatcttgtcgat
tatgaaacggaggcgttactgataaaaagttcaataatcacgtgtctggaaccgttcatt
ccgtttcttcaatacgattttgagctacttataaaagtcatacacaagatatttcactct
gcttcgtatcagcatccaaatgaagaagattttgggcataaagcattcgagttcagacga
acagcagcctcggtatggattagactctgtctctcgcattacaaactgttgattaatatt
cttgatgatctaacaaaacacattcaaatgtcgtacgacaacgatagctgcacgagcttg
gagcgatcgctattggcagaaggcttggttgttataagcaatggttatgtcaatttcgag
aaacaagagaaatacataaatgaacttttggctccaataagggaggattggatgagcccc
gaattggaacaggcgctgtcttcacctgaagcatttttatcctttattggtctgtacaat
tcaaacgaagacgaacacataacgcaaaaaagacgatacacgctaaatatgtgccaacga
tacatccacgctgttttgaaacgtatcgagatacccaaagattctcaggcacaaatcaat
ggtggattcaagacgagacacgaagacgtgccaagaaatccagggacatcttcagttctt
cctttgttgtcaaatatatttcatctgaacagggtattcagcagaatttgggatccagct
gtgcgtgtgaaaatccctcaccatcttcaacccgcattggacatacacgaatcagaaaaa
gcagccattttcggtctcgacgcacgagatggtgaagaaagacccaaggcagaaccaaag
cggtcccctgttgataacatgaagacctttctctttaaattgaatgaagcatgtgccatg
acgcttgcggattgttcacggttgggagaaggcttttatggagcgccatcacttggccaa
catatcgttacctatgtcattgaaccgtggagatatgtgccaaactacaggctgcgaatt
ttcattcgcggatttttcaagatgtactgtcgagtgtgcccgccatcttactacgagtca
gcggtcgttcccgtggtggttgcggcgttatctctgatgatcgatcatttaaacaaagac
tgggaagtcgttcgtagcagagagattgtcaggccccatcttgcatacatcgaggctcct
gatatcgacgatgaagaagaggctgataaagacagtgaaatcatcgagaatcaactggtt
catcttttgacaaaaaactttatggaagcattcttttcaatgtgcaccatgaaaagaccg
actcattttgaaagcaattccccgcttacaaccgaagaaccaggacaagttctgcttaag
ccagactgttccgaggacatgttggaagaacttcctcagtttttactgagacacccaaaa
acatgcaagattttccttttcctgccgttcgtatctttgcaatggccggacacagctggt
tttgtcaaagctgcaaagctttgcgttccgtttgtaaaacagatcgtgaaaaacccgccc
acaggtgttgccatgagccaggaaatgtttgatcagattttcacgctatgtcttaagggt
ttacaactcatgggccatcacgtcgaaataggagcacaactcattcgaaacgcggtcaca
atttacgacatcctgcgccctctgtttccaagtttaaaggatattcttctgcaagttcca
aacgtggatcctgccgtagtgaacaattacgatctcacgttgctgtctgaaaacagccac
acggagaagcaaaagaggaagatatttcgaggtcttctgtctggtcttattggaaaagaa
atcgggaagttgtttcagaatgatataactatactaaaccttcccgccttgcctgtcatc
aacaaagaaacaccttcgactctggctgatatagaaaatccggactacggattgacaaga
cttttcgagcccacaaaaccctag

DBGET integrated database retrieval system