KEGG   Dendronephthya gigantea (soft corals): 114523145Help
Entry
114523145         CDS       T06112                                 

Definition
(RefSeq) farnesyl pyrophosphate synthase-like
  KO
K00787  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
dgt  Dendronephthya gigantea (soft corals)
Pathway
dgt00900  Terpenoid backbone biosynthesis
dgt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgt00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    114523145
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:dgt01006]
    114523145
Enzymes [BR:dgt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     114523145
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     114523145
Prenyltransferases [BR:dgt01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   114523145
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-GeneID: 114523145
NCBI-ProteinID: XP_028399803
Position
Unknown
AA seq 380 aa AA seqDB search
MRFVLPYFKGARAYFCVAKQYFTIGSNLTMNMNSVSRKAQLVSDRKKFDELLPKIIDQII
GQPCKETKDAMDHYQKSVMYNLPGGKMNRGLTVMATWRCLLGERTASDEEYFSAIVLAYC
VELLQASFLVADDVMDQSQTRRGKPCWYKKENIGLVAINDAFMLECSVYKLLDINFQDKK
CYPNLITLLHRTTFQTETGQTLDLITKPGENFCNFTLERYKAIVRWKTGYYSFYLPVALA
MYMMNITDKEIHERTKDILLEMGEFFQIQDDYLDCYGDPEVTGKVGTDIEDTKCSWLLVQ
ALQRVDQEQMNVLKENYGVNDPVAVAKVKEIYSKLNMKKVYQDYEEISYLKLMALIDKAP
SEMPKEIFTELAGKIYKRDK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgagatttgttttgccatattttaaaggagcaagggcatatttttgtgtggctaagcaa
tatttcactataggttctaacttgacgatgaatatgaattctgtctcaagaaaggctcag
ttagtttcagatagaaagaaatttgatgaattgttgccaaagatcattgatcagatcatt
ggtcagccttgcaaggaaaccaaagatgccatggatcattatcagaagtctgtcatgtat
aatcttcctggaggaaaaatgaatcgtggtttgacagtaatggctacttggcgttgccta
ttgggagaaagaacagcctcagacgaggaatatttctctgcgatagttctggcctattgt
gttgagttgcttcaagcatcttttctggttgcggatgatgtgatggaccaatcacaaaca
agacgaggaaagccgtgttggtataaaaaggagaatattggcctggtcgcaataaatgat
gcttttatgcttgagtgttctgtctacaaactacttgacatcaattttcaggataagaaa
tgttatcctaacctaatcactttgctacatcggacaacttttcagactgaaactggtcaa
acattagatcttataaccaagcctggtgaaaacttttgtaattttacattagaaagatac
aaggcaatcgtaagatggaagactggatactactcattttacctaccagtcgctctcgct
atgtatatgatgaacattacagataaagagattcatgaaagaaccaaggatattttactt
gaaatgggagaattttttcagattcaggatgactatcttgattgttatggcgatccagag
gtaacaggaaaggttgggacagatatcgaagatacgaaatgttcctggctgttagtacaa
gctctgcagagagttgatcaagaacagatgaatgtattgaaggagaactacggcgtcaat
gatccagtggcagtagcaaaagtgaaagaaatttactccaaattgaacatgaaaaaagtc
taccaggattatgaagaaattagttatctaaagttgatggcacttatcgacaaagcgcca
agtgaaatgccgaaagaaatcttcactgaacttgctgggaaaatatacaaaagagataaa
taa

DBGET integrated database retrieval system