KEGG   Dendronephthya gigantea (soft corals): 114523321Help
Entry
114523321         CDS       T06112                                 

Definition
(RefSeq) guanylate cyclase soluble subunit alpha-2-like
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
dgt  Dendronephthya gigantea (soft corals)
Pathway
dgt00230  Purine metabolism
dgt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgt00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    114523321
Enzymes [BR:dgt01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     114523321
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB
Motif
Other DBs
NCBI-GeneID: 114523321
NCBI-ProteinID: XP_028400007
Position
Unknown
AA seq 671 aa AA seqDB search
MLAFIHKILYDLVVETFGVQKWNEIRDEAGLSENDTEEFCDSDNHGKVYEDEMIWRIVKI
ASRVLDTPEDDLLDAFGVKFVNVSFNDHQKMLTSLGCSLHTMLNNLDHMHQVFKEAKRYD
GMRAPSFTCEPADKKGHVLTVHYFSGRRGLEKFVCGALRQCAKVLCDVTVVVDVFKKFDP
ETGCVTFKIESSDVPLTDQVNDEVHGIKRKKSSNVKDLPINMETFCKAFPFHIIFNRNFE
IVQMGSALVRILGGSLLNQNNRLSDYFQLVRPDIEWSFRSIQAQCNSSFLLHLNSAVSEK
TQRVMNLTGQMIHMPESECILYVGSPVVENLDHLRKQGLYISDIPIHDATRDLILVSEQS
KAQGGLKKRLQSLKAKVQETSAELEHEKKKTEDLLEAIFPKEVAQQLIHKKPVDAQTIES
VTMLFSDLVGFTAICGKCVPMDVVNMLSALYTKFDTRCTELELYKVETIGDAYVVAGGLD
VKMTDHAYRIALMALSMMESAAQVVSPENKPLRMRIGIHTGSVVTGVVGVKMPRYCLFGN
NVTLANKMESGSEAGKINVSPATYKYLKSFNAFSFEMRDQSVLPDAYPRCGNETCYFLTR
KASSAGKSKMVVKVTVTEENAPPNHTLEKIEESKKNNPYNEVKLTPAESNNKGKVKERSP
RRWETRFCSLT
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcttttatacacaaaatcctatacgatttggtcgtagagacatttggcgtgcag
aaatggaacgaaataagggacgaagcgggtctctcagagaacgatacagaagagttctgc
gactcggacaaccacggaaaggtctacgaagatgaaatgatttggagaattgtgaagatc
gcatcgcgagtattagacacgccagaagacgacttgttggatgcgttcggagtaaaattt
gtaaacgtgagcttcaatgatcatcagaaaatgttaacatcactcggatgttcattacac
actatgctgaacaacctggatcacatgcaccaagttttcaaagaggcgaagaggtatgac
ggcatgagagcgccatcgtttacctgcgaaccagctgataaaaagggacatgtcctcaca
gtacattatttttccgggcgaaggggtttggagaagtttgtttgcggagcattaagacaa
tgtgccaaagtgttatgcgatgtaactgtagttgtagacgttttcaagaaattcgatccg
gaaactgggtgcgtgacattcaagattgaaagttcagatgtgccgctgactgaccaagtc
aatgatgaagttcatggaataaaacgcaagaagtcctcaaacgtcaaggatctcccgatt
aacatggagacattttgtaaagcctttccgttccatattatcttcaaccgaaattttgaa
attgtgcaaatgggaagcgcactcgtgcgaatactcggtggaagccttttgaatcaaaac
aatcgattaagtgactactttcaactggttaggccggatattgagtggagctttcgttca
attcaagcacaatgcaattcatcatttctgctccatcttaacagtgcagtttccgagaaa
acacaacgagttatgaatctcacaggacaaatgatccacatgcccgaatcggagtgcata
ctttacgttggttccccagttgtggaaaacctggatcacttgcgcaagcaaggattatac
atcagtgatattccaatccacgatgcgactagggatttgattttagtaagcgaacagtca
aaggcgcaaggcggtctaaagaaacgactgcaatcactgaaggcgaaagtacaagagacg
tccgcggaacttgaacatgagaaaaagaaaactgaggatttattagaagcaattttcccc
aaagaggttgcacagcaacttattcataagaaacccgtagatgcgcagacaatcgagagc
gttacgatgttgttcagtgatcttgtgggcttcacggcaatatgtggaaagtgcgtcccc
atggatgtcgtgaatatgttaagtgctctgtacacgaagtttgacacgagatgtacagaa
ttagagttgtataaggttgagacaattggtgacgcatatgtcgtagcaggtggattggat
gttaaaatgaccgaccatgcttatcgtatagcgctgatggcgctttctatgatggaatcc
gcggcccaggtggtctcgccagagaataagcccctgcgcatgcgcattggcattcatact
ggatccgtcgtgactggagttgttggagtgaaaatgccacggtattgtttatttgggaat
aacgttactcttgctaacaagatggagtcgggaagtgaggctgggaaaattaacgtgagt
ccggcaacatacaagtatttgaagtcgttcaacgcgttttccttcgaaatgcgcgaccaa
agtgtcttgccagatgcatacccaaggtgtggtaacgagacgtgctactttctcaccaga
aaagcaagcagtgccggcaaaagtaaaatggtggtcaaggtaacggtcacagaagagaat
gctccaccaaatcatactttggaaaagatagaagagagtaagaaaaacaatccatataat
gaagttaaattaacaccggcggaatcaaacaacaaagggaaagttaaggagcgttcacca
cgtcgttgggaaacacggttttgttcactcacgtga

DBGET integrated database retrieval system