KEGG   Dendronephthya gigantea (soft corals): 114524637Help
Entry
114524637         CDS       T06112                                 

Definition
(RefSeq) MAP kinase-activated protein kinase 2-like
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
dgt  Dendronephthya gigantea (soft corals)
Brite
KEGG Orthology (KO) [BR:dgt00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dgt01001]
    114524637
Enzymes [BR:dgt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114524637
Protein kinases [BR:dgt01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   114524637
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo APH
Motif
Other DBs
NCBI-GeneID: 114524637
NCBI-ProteinID: XP_028401585
Position
Unknown
AA seq 357 aa AA seqDB search
MNALFGTSTPFETKKSPITDVYTITTTVLGVGINGKVVECVEKKTGFKYALKVLQDNAKS
RRELGLHWKAGACPFIVKIKEVYENKFMRRDSLLAVMECMTGGELFEAIQRRSETHQPFT
EREAAEIIRTVTLALAHLHSMDIAHRDLKPENLLFTNKQPNAVLKLTDFGFAKETTPDKL
TLQTPCYTPYYVAPEVLGPQMYDKSCDMWSLGVIMYILLCGFPPFYSNHGAAISPGMKKR
IRQGQYSFPDPEWSNVSTQAKELIRGLLKTNPHERYTVEKVINNPWIKAYTEVPSTPLHT
ASVLKDETDNWEDMQAEFDLTLQSMRVDFEKPIILKTVDKAKNSLLGRRKKSKESSK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccttatttgggacaagtactccgttcgaaacgaaaaagtcgccgataactgat
gtatataccattacaactacggttcttggggtcggcattaacggcaaagttgttgaatgt
gtagagaaaaaaaccgggtttaaatacgcgttaaaggtattgcaagataatgcaaaatca
agaagagagttaggtttacattggaaggctggtgcatgtccatttattgttaagattaaa
gaggtttatgagaataaatttatgagacgagactctttactggctgtcatggagtgtatg
actggtggagagttatttgaagctattcaacgtaggtctgaaacacatcagccattcaca
gaaagagaggctgcggaaataattcgaacagtcacacttgctcttgctcacttgcattca
atggacattgctcatcgtgatttaaagcctgaaaacttacttttcacaaacaagcagcca
aatgctgtgctgaaattgacagattttggatttgcaaaggaaacaactcctgataaatta
accctacagacaccatgctatacaccttactatgtagctccagaagtacttggccctcaa
atgtatgacaaatcgtgtgatatgtggtcgttaggtgtaattatgtatatcttgctttgt
ggatttccgccattttacagtaaccatggcgcagcgatttcacccggtatgaagaaacgt
atccgacagggacaatatagttttccagatccagagtggagtaatgtctcgacacaagca
aaagaattgattcgagggctactgaagacaaacccacacgaaagatatacggtcgaaaaa
gttataaataatccttggataaaggcatatactgaagttccgtcaacacctctacataca
gctagtgttttaaaagatgaaacagacaattgggaagatatgcaggctgagttcgacctg
acgctgcagtcaatgcgtgttgacttcgagaaaccaatcatattgaagactgtagacaaa
gcaaagaactcgcttcttggaagaagaaaaaagtcaaaagaaagctcaaagtaa

DBGET integrated database retrieval system