KEGG   Dendronephthya gigantea (soft corals): 114527838Help
Entry
114527838         CDS       T06112                                 

Definition
(RefSeq) ATP-dependent RNA helicase DHX8-like
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
dgt  Dendronephthya gigantea (soft corals)
Pathway
dgt03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:dgt00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    114527838
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dgt03041]
    114527838
Enzymes [BR:dgt01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     114527838
Spliceosome [BR:dgt03041]
 Complex C
  Other components
   Step II factors
    114527838
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C S1 DEAD AAA_22 AAA_19 T2SSE AAA_30 Apt1
Motif
Other DBs
NCBI-GeneID: 114527838
NCBI-ProteinID: XP_028405343
Position
Unknown
AA seq 1194 aa AA seqDB search
MEELEQLERLSLVSKICTELENHLGINDKDLAEFIIMLGETNETLGKFKAALKQNGAEFP
DSFSSNLLRLIQQMKPTSGAQTDSKINDDFAGDNEELSKKRQKFHGLCLPDEEPKSEEVE
KSVDKDEAVVSQAMGELEALMAKAKEDESKVKSKNTERESSRSPRRQRRRSRSRSKERRS
RRSRSRSHDRDRDKRRRRSRSNERKGRDDDRHSRRRSDDRRHGGSSRVEKPPPDKPTVNQ
IYDGRVTGIMQFGCFVQLEGLRGKNEGLVHISELRREGRVANVADVVSRGNKVKVKVLSM
TGTKISLSIKDVDQSTGEDLNPTRMRHNMPGDSSAMTRNPDRPSVASVPVYDDDSAREKR
KVQRVTSPEKWEIKQLISAGVLDKADYPDFDDETGVLPQREDDSDEDVEIELVEEEPPFL
NGQTKLSVDMSPVKIVKNPDGSLQRAAMTQTALAKERRELKQAQREEQANSVPKDLGKLW
VDPVPSGDDDRPQFAQEAKGIGLSAKDDMPEWRKASFGGKKVSYGKKTNLSILEQRQSLP
IYKLRDELVKAVHDNQLLIVIGETGSGKTTQITQYVAEAGLASVGKIGCTQPRRVAAMSV
AKRVSEEFGCRLGQEVGYTIRFEDCTSPETKIKYMTEGMLLRECLIDPNLTQYSMVMLDE
AHERTIHTDVLFGLMKKAVKKRPDLKLIVTSATLDAVKFSTYFFEAPIFTIPGRTFPVEI
LYTKEAETDYLDAALVTVMQIHLTEPPGDILVFLTGQEEIDTSCEILYERMKSLGPEVPE
LIILPVYSALPSEMQTRIFEPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYN
SKSGMDALVVTPISQAQAKQRSGRAGRTGPGKCYRLYTERAYRDEMLQTAVPEIQRTNLT
STILSLKAMGINDLLAFDFMDPPPMETMITAMEQLHSLGSLDDEGLLTRLGRRMAEFPLE
PPLSKMLIQSVHLGCSDEILTIVSMLSVQNVFYRPKEKQALADQKKAKFHQGEGDHITLL
AVYNSWKNNKFSNPWCFENFIQARSLRRAQDIRKQMLGIMDRHKLDIVSCGKNVNRVQKA
ICSGFFRNAARKDPQEGYRTLVDNQVVYIHPSSALFNRQPDWVIYHELVLTTKEYMRECT
AIDPKWLVEFAPSFFKVGDPTKLSKRKRQERLEPLYNRYEEPNAWRISRAFRRR
NT seq 3585 nt NT seq  +upstreamnt  +downstreamnt
atggaggagttggaacagttagaaagactctcgcttgtctcgaagatttgcacagagttg
gagaatcatttgggtattaatgacaaggaccttgccgagtttattattatgcttggagaa
accaatgagacactggggaagtttaaagctgcactgaaacaaaatggagcagaatttcct
gattcattttcttccaatctgctgcgtcttatccaacaaatgaaaccaacatctggagca
caaactgacagcaaaataaacgatgattttgccggagacaacgaagagttatcgaaaaaa
agacagaaattccatggcctctgtttgccagacgaagaaccaaaatcggaggaagtagag
aaatcagttgataaagatgaagcagttgtttctcaagcaatgggagagctggaagcacta
atggctaaagcaaaagaagatgagagcaaagtaaaaagcaaaaatacagaacgtgagagc
agtcgcagtccacgtagacagcgaaggcgatctcgcagcagaagtaaagaacggaggagt
cgaagatctcggtctcgaagccacgacagagatcgcgacaagagaagacgacgatcaaga
agtaatgaaaggaaaggtcgtgatgatgatcgacacagcaggagaagaagcgacgataga
cgccatggaggatcatctcgggttgaaaaacctccaccagataaacctaccgttaaccag
atttacgatggacgggttactggaatcatgcagtttggatgctttgttcagttggagggt
cttcgcgggaaaaatgaaggccttgtgcacatctcagagcttcgacgagaaggaagagtg
gctaatgttgctgatgtggtaagccgtggtaataaagtcaaggttaaagttctatctatg
actggaaccaaaattagtctgagtataaaggatgtcgatcaaagcacaggggaagacttg
aatccaacgaggatgcggcacaatatgccaggcgattcatccgcaatgacgagaaaccca
gacagaccttcagtggcatcagtacctgtttacgacgatgattccgcaagggaaaaacgt
aaagtgcaacgtgtcacctcgccagaaaaatgggaaatcaagcagcttatatctgctggg
gttttggacaaggctgattaccctgacttcgatgacgagactggagtattaccacaacga
gaggacgactcggatgaagatgtcgaaattgaattggtcgaagaggaacctccattccta
aatggacaaaccaagttaagcgttgatatgagtcctgttaaaatagtcaagaatcccgac
ggttctctccagagagcagccatgactcaaactgcacttgcaaaagaacgacgtgaattg
aaacaagctcaaagagaagagcaagcgaattctgtaccgaaagatcttggaaagctgtgg
gttgatcccgtgccttctggtgacgatgaccgaccacagtttgcgcaagaagcaaaggga
attggactgtctgcgaaagatgacatgcccgaatggcgtaaggcttcttttggaggcaag
aaagtatcgtatggcaagaaaacaaatctctctatcttggaacagagacaaagtttgccc
atatataaacttagagatgaattagtcaaggcggtgcacgataaccaactactcatagtt
attggagaaacgggcagtggtaaaactactcaaataacacaatatgttgccgaggccggc
ctggcgtcggtaggcaaaatcggatgcactcaacctcgtcgtgttgcggccatgtcggtt
gcgaagagagtctcggaagaattcggttgtcgtttaggtcaagaggttggatacaccatt
cgttttgaagattgcaccagtcctgaaacaaagatcaaatacatgacggagggtatgttg
ctgcgggagtgtttaatcgatccaaacctcacgcagtactcaatggtcatgttggatgaa
gcacacgaaaggactattcatacggatgtcttgtttggtctgatgaaaaaagccgtgaag
aaaaggcccgacctgaaattgatcgtcacttcggcaacgctcgatgctgttaagttctcg
acgtatttcttcgaggctccaatattcacgattcccggtcgtacattccccgtggaaata
ttgtatacaaaagaggccgagactgattatcttgatgcagctttggtcacagtcatgcag
atccatctgacggaaccgcctggtgatatcctcgtctttttaacaggtcaggaggagatt
gacacatcgtgtgagatcctttatgaacgtatgaaatctcttggtccggaagtacctgag
ctcattatcttacctgtgtacagcgcattgccaagtgagatgcagactagaatttttgag
cccgcaccacccggaagtagaaaggttgtcatcgcgacaaatatcgctgaaacatctttg
acgatcgacggcatctattacgttgttgaccctggcttcgttaaacagaaagtgtataac
tccaagagtggtatggatgccttggtagttactccaatttcacaggcccaggctaaacag
cgatcggggcgagcaggtcgaacagggccggggaaatgctacagactgtacacagagcga
gcatatcgtgatgaaatgctacaaactgctgtaccagagattcagcgtacaaacctgact
agcacaatcttgtcattgaaagccatgggaattaacgatttactggcatttgatttcatg
gatcctcctccaatggagacgatgatcacagcaatggagcagttgcactcgcttggttcg
ctagatgatgaaggtctcttgacaagacttggtcgaaggatggctgagttccctcttgag
ccacccttatcaaaaatgttgatacagtctgtccatctgggctgcagcgatgaaattctc
acaattgtttccatgttgtccgttcagaacgtcttttaccgtcccaaggagaaacaagct
cttgcagaccagaaaaaggcgaagttccatcaaggtgaaggggatcacatcacgttgctg
gctgtgtataattcttggaagaataacaaattttcgaacccgtggtgtttcgaaaacttc
atacaggcgagatctctgagaagagctcaagatattcgaaaacagatgcttggcatcatg
gacaggcacaagctggatatcgtgtcgtgtggaaagaacgtcaaccgcgttcagaaagca
atatgcagcggtttcttccgaaatgcggctcgaaaggacccacaggagggttacaggaca
ttagtggataatcaagttgtatacattcatccttcgagtgcgctgttcaaccgccagcct
gactgggttatctatcatgaactagtattaactactaaagagtacatgagagaatgtact
gcaatagatccgaaatggcttgttgagtttgcgccatcatttttcaaggtaggagatcca
acgaaactgagtaaacgaaagaggcaggaacgcctggaaccactctacaacagatacgag
gagccaaacgcctggcgtatttcaagggcatttcgaagacgatga

DBGET integrated database retrieval system