KEGG   Dendronephthya gigantea (soft corals): 114532764Help
Entry
114532764         CDS       T06112                                 

Definition
(RefSeq) tRNA (cytosine(34)-C(5))-methyltransferase-like
  KO
K15335  tRNA (cytosine34-C5)-methyltransferase [EC:2.1.1.203]
Organism
dgt  Dendronephthya gigantea (soft corals)
Brite
KEGG Orthology (KO) [BR:dgt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dgt03016]
    114532764
Enzymes [BR:dgt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.203  tRNA (cytosine34-C5)-methyltransferase
     114532764
Transfer RNA biogenesis [BR:dgt03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    114532764
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltr_RsmB-F FtsJ
Motif
Other DBs
NCBI-GeneID: 114532764
NCBI-ProteinID: XP_028410148
Position
Unknown
AA seq 801 aa AA seqDB search
MSRKKGNRGPKKKNSHFSGKRKPRESYDDIVKENELLEKFYKAQHVVPEDEWESFMESLR
AALPSTFRITGIRGHAEELLKYLKKYYIEKLNGAKEELGEELDCFGKPLTWYPDELAWQI
NLTRRFIRRSGMVSNFHKFLIHEAEMGNLSRQEAVSMIPPLLIDVEPHHKILDLCAAPGS
KTAQLIEMLHEKEPTTLPEGFVIANDIDPKRCYMLVHQSRRIHSPCCLVTNHDAASFPDI
NIKQEGSEEVSPMLFDRILCDVPCSGDGTMRKNPQIWKKWNPEIGVNLHKIQLRILVRAV
EMLAIGGRVVYSTCSMNPVEDEAVVSQLLLRTQGSVELIDVSDRLPLLKRSPGLLHWKIQ
TKDGRPVPSFTECSTSDRTHGFLESMWPPSIEDAEKFNLKRCWRLYPHQQDTGGFFIAVL
EKKSPLPWTAGFRPHHKLLPWEITKKEKKESKRAEVIEDENEGKVTENMSKENENNSAEL
RKPSLENCEETTNEKDLDKVELEKPAEERTESDVKCPGVTEPQRKRRKFDPKSDCKENPF
VFVEDVDTHWNTIRKFYEISSDFPESVLLVRSASERKRTIYFVSVGLAAMLKNVDQEKFN
VINAGLRLFTRCENSDQDWSFRINGEALETILPFLSNKRVINVPQEDLVRILVDTSPKVS
QMTTETKSALGNIGPGCIVFSYDPKNRKEVDTLSVKIAVCGWRSNTVILRSLIAKGDRMH
YLRIAGYAPDSQEIQALVSDPKVSLEEPSFQVETDSPTSEQVDSNSSMKIKDQTEEEMLD
DTEEDMVEPSTLTDNVASEQN
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagaaaaaagggtaatcgtggaccaaagaagaaaaacagtcactttagtggaaag
agaaaacctcgagaatcctacgatgacattgtgaaggagaatgaactgcttgagaaattt
tacaaagctcaacatgtagttcctgaggatgaatgggagagttttatggagagtttaagg
gcagcattgccatcaacattcagaataacaggaataagagggcatgcagaggaacttcta
aaatatttgaaaaaatattatattgagaaattgaatggtgctaaagaagaacttggtgaa
gaactggactgctttggtaaaccattaacatggtacccggatgagttagcttggcaaatt
aatttaactcgacgatttatcagacgatcgggcatggtgtcaaattttcacaaatttctt
attcacgaagctgaaatgggtaacttaagccgtcaagaagctgtgagtatgataccacct
ctcctcattgatgttgaacctcatcataagatattggatctttgtgcagcacctggttca
aagacagctcagttgattgaaatgctccatgagaaagagccgactaccttgcctgaaggt
tttgtaatagctaatgatattgatccaaaacgttgttacatgttggtccatcaaagtcga
agaattcacagtccttgttgcttggtaacaaatcatgacgcagcttcatttcctgatatt
aacatcaaacaggaaggctcagaggaggtgtcaccaatgctgtttgacagaatattgtgt
gatgttccttgcagtggagatggcacaatgagaaaaaatccccaaatttggaagaaatgg
aatccagaaattggtgtgaaccttcacaaaatccagttaagaattcttgtaagagcagtt
gagatgttagctattggtggtagggttgtttattccacatgttctatgaatcctgtagaa
gacgaagctgttgtttcccagttgcttctaagaactcagggctcagttgagttgattgat
gtgtctgacagattgcctctcttaaaaagatcacctggtcttcttcactggaagattcag
acaaaagacggtaggccggttccaagcttcacagaatgcagtacatctgaccgcacgcat
ggctttcttgaatcaatgtggccacccagcatcgaagacgcggagaaattcaacttgaaa
cgttgttggcgattatacccacatcaacaagacacgggagggttctttattgctgttctg
gagaagaaatctccattgccgtggacagcaggatttcgtccacatcataagttgttgcca
tgggaaattacgaagaaggaaaagaaggaatcaaaacgtgctgaagtcatcgaggatgaa
aatgaaggaaaggtaacggagaacatgtcaaaagaaaatgagaacaactccgctgaattg
aggaaaccatcgctggaaaattgcgaggaaacgacgaatgaaaaagacttggataaggtg
gaattagaaaaacccgcagaagaaagaacagaatccgacgtaaaatgtccaggtgtaaca
gaacctcaaagaaaaagaagaaaatttgacccgaagtccgactgcaaggagaatccattt
gtgttcgttgaagatgtggacactcattggaatactatcagaaaattctacgagatttcc
agtgattttccggagagtgttttactggtgcggtcagctagtgaaagaaaacgcacgatt
tactttgtatctgttggacttgcagccatgttgaaaaatgttgatcaagagaagttcaat
gtcataaatgctggcttaagattatttacaagatgcgaaaatagtgatcaagattggtcg
tttagaattaatggagaggcccttgagacaatcttgccgtttctgtcaaacaaacgtgtg
atcaatgtacctcaagaggatctcgttaggatattggtggatacgagtccgaaagtctct
caaatgacaacggagacgaagtccgcgcttggaaatatcggccctggttgtattgttttt
tcatatgatcctaagaatagaaaagaggtggacacacttagcgtaaaaatcgctgtctgt
ggttggagaagcaacacggttatcttacgcagtttgattgctaagggagacagaatgcat
tatcttcgaatcgctggttacgctccagactcgcaggaaatccaggctcttgtttctgat
cctaaagtaagtttggaggaaccatcttttcaagtggagacagactcaccaacaagtgag
caagttgactcaaattctagcatgaaaattaaggaccaaacagaggaagaaatgttggat
gatacggaagaagatatggtagaaccaagtactttgactgataatgttgctagtgaacaa
aattaa

DBGET integrated database retrieval system