KEGG   Dendronephthya gigantea (soft corals): 114534199Help
Entry
114534199         CDS       T06112                                 

Definition
(RefSeq) ATP-dependent RNA helicase HAS1-like
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
dgt  Dendronephthya gigantea (soft corals)
Brite
KEGG Orthology (KO) [BR:dgt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dgt03041]
    114534199
   03009 Ribosome biogenesis [BR:dgt03009]
    114534199
Enzymes [BR:dgt01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     114534199
Spliceosome [BR:dgt03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    114534199
Ribosome biogenesis [BR:dgt03009]
 Eukaryotic type
  90S particles
   Helicases
    114534199
  Pre-60S particles
    114534199
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C DUF4217 AAA_30 AAA_22
Motif
Other DBs
NCBI-GeneID: 114534199
NCBI-ProteinID: XP_028411553
Position
Unknown
AA seq 580 aa AA seqDB search
MEDKEFRKKRKKISTGGPSGKKVRKLKKKFSNPVEEERVESVEQNIKPNEMNESRVIEGI
DNTEENEYEEHTSLNPTALSTNDDTSFESLRESVSEKTLRAISDMGFVNMTEIQHKSIVP
LLNGRDLLGAAKTGSGKTLAFLIPAIELLYKLQFKPRNGTGVIIISPTRELSLQTFGVVT
DLIKHHNHTYGIIMGGANRKNEAEKLQKGVNLLVATPGRLLDHLQNTHGFKFKNLQCLII
DEADRILQIGFEEEMKQIIRILPGRRMTVLFSATQTKNVEDLARISLKKAPLYVGVDDNK
ETATVEGLEQGYLVVPSDKRFLVLFTFLKKNRDKKVMVFFSSCHSVKYHSELLNYIDLEV
LDIHGKQKQQKRTTTFFQFSQAKSGILLCTDVAARGLDIPEVDWIVQFDPPDDPKEYIHR
VGRTARGAHGKGHALLFLLPEELAFLRYLKHAKVPLNEYNVSSSKIANIQSQLEKLIAKN
YYLHKSAKEGYRSYLQAYASHQHRDIFSVNTLDLQKVAKAFGFQVPPAVNLAVHSSKGER
PRKRGGGGGFGIGYRNSKTMKKIKTFKHKKVNKDTRQFSR
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggaagataaagagttcagaaagaagcgaaaaaaaatttccactggtggcccttcaggt
aaaaaggtaaggaaattgaagaagaaattctcaaaccctgtagaggaagagagagttgaa
agtgttgaacaaaatattaaacccaatgaaatgaatgagtctcgtgtcattgagggcata
gacaatacagaagagaatgaatatgaagaacacacttcccttaacccaacagcattgtca
acaaatgatgacacatcctttgagtctttaagagaaagtgtgtcggaaaaaacgctaagg
gctatttcagatatgggctttgtaaatatgactgaaatccaacataagagtatagtgcca
ttgctcaatggaagagatttactgggtgcagccaaaactggaagcggaaagactttggca
tttttaatcccagcgattgagctactttacaaacttcagtttaagcccaggaacggcaca
ggggtaatcataatttccccaacacgagaactttccctacaaacatttggcgtggttaca
gacttgataaaacaccacaatcacacgtatggcatcattatgggtggagccaatagaaag
aatgaggctgaaaagcttcagaagggcgtcaacctgttagttgcaacgccaggacgactc
ttagaccatttacagaacacgcatgggtttaaattcaagaatttgcaatgcctcataatt
gatgaagctgatcgaatattgcagattggcttcgaagaagaaatgaaacagattattcga
attttaccaggtcgtcgaatgacggtattattttctgcaacacaaacgaaaaatgttgaa
gatttagcgagaatatcattaaaaaaagctccattgtatgtgggcgttgatgacaataaa
gaaacagcaacagttgaaggcttagagcagggttatttagttgtgccgtcagacaaacgt
ttcttggtcttatttacgtttttgaagaagaatcgggataagaaagtaatggtgtttttt
tcatcttgtcattctgtgaaatatcattctgaacttcttaactacattgatctggaggtg
cttgacatacacggcaaacaaaagcaacagaagcgtacaacgacattttttcaattcagc
caagcaaaatctggtatcttactttgtactgacgtcgcagctcgtggccttgatatccct
gaggtagactggatcgtgcagtttgacccccctgatgatcctaaggaatatattcacaga
gttgggcgaacagcgcgcggtgcacacggaaaaggacacgctcttttattcttacttcct
gaggaactggctttccttcgctacttaaaacacgcaaaggttcctcttaacgagtataac
gtgtcgtcgtccaagattgccaacattcagtcccagcttgagaaattgatcgcaaagaac
tactacctacacaagtctgcgaaggagggctataggtcgtatcttcaggcgtacgcctcg
catcaacacagagatatattcagcgtgaatacgttagatctgcagaaagttgcaaaggct
ttcggttttcaagttccccctgctgtaaatttagctgtccacagcagtaaaggagagcga
cctcgaaagcgtggaggtggtggcggatttggtattggttacagaaactctaaaacgatg
aaaaaaattaagactttcaaacataagaaggttaacaaagataccagacagtttagtaga
tag

DBGET integrated database retrieval system