KEGG   Dendronephthya gigantea (soft corals): 114537534Help
Entry
114537534         CDS       T06112                                 

Definition
(RefSeq) acetyl-CoA acetyltransferase, mitochondrial-like
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dgt  Dendronephthya gigantea (soft corals)
Pathway
dgt00071  Fatty acid degradation
dgt00072  Synthesis and degradation of ketone bodies
dgt00280  Valine, leucine and isoleucine degradation
dgt00310  Lysine degradation
dgt00380  Tryptophan metabolism
dgt00620  Pyruvate metabolism
dgt00630  Glyoxylate and dicarboxylate metabolism
dgt00640  Propanoate metabolism
dgt00650  Butanoate metabolism
dgt00900  Terpenoid backbone biosynthesis
dgt01100  Metabolic pathways
dgt01200  Carbon metabolism
dgt01212  Fatty acid metabolism
Module
dgt_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:dgt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    114537534
   00630 Glyoxylate and dicarboxylate metabolism
    114537534
   00640 Propanoate metabolism
    114537534
   00650 Butanoate metabolism
    114537534
  09103 Lipid metabolism
   00071 Fatty acid degradation
    114537534
   00072 Synthesis and degradation of ketone bodies
    114537534
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    114537534
   00310 Lysine degradation
    114537534
   00380 Tryptophan metabolism
    114537534
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    114537534
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dgt04147]
    114537534
Enzymes [BR:dgt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     114537534
Exosome [BR:dgt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   114537534
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 114537534
NCBI-ProteinID: XP_028414387
Position
Unknown
AA seq 421 aa AA seqDB search
MAAYFFKSSRHLNFVSKSHRLIYKIGRSFSTSQDIVIVSAARTPVGSFRSSLSSVPATKL
GSVAIQAAIERAGISNGDVQEVFMGNVCSAGAGQAPTRQAALGAGLPISTPCTTINKVCA
SGMKSIMLAAQSLACGSQEIMVAGGMESMSNVPFYMGRDAPSYGGHKLEDGIVKDGLWDV
YNQIHMGSCTEKTAKDHNLSREEQDEFAISSYKKTSSAHEKGIFKKEIVPVSVPQRRGKP
DIVVEEDEEFKKVNFDKFNQLKPVFQRDGGTITAANASTLNDGAAAVVLMTAKIAEKMGV
KPLARIIGFCDAAVAPIDFPVAPAEAMPKLLKLTGLKKEDITMWEINEAFSAVVLANIKI
MGLDPDKVNINGGAVSLGHPIGMSGARLVGHMTHHLNPGEKGLASICNGGGGAAAIVIER
L
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggccgcatatttcttcaaatcttctagacatttaaactttgtgagcaagtctcatcga
cttatatataaaataggaaggtctttttccactagccaggatattgtgatagtaagtgct
gctcgtacaccagttggttcattccgaagctccttatcatctgttcccgcaacaaaacta
ggttctgttgccatccaggctgccattgaaagagcaggaatttcaaatggagatgtccaa
gaagtgtttatgggcaatgtttgctctgctggtgctggtcaggcacccaccaggcaggca
gcattaggtgcaggtctaccaatatcgacaccatgtaccactatcaacaaagtttgtgct
tctggcatgaaatctataatgctagctgctcaatcattggcctgtggtagtcaggaaatc
atggttgctggagggatggaaagtatgtctaatgtcccattttatatgggtagagatgcc
ccaagttatggtggccataaactagaggatggtatcgtgaaagatggtttgtgggatgtc
tataatcagattcatatgggatcatgcacagagaagacagccaaggatcataatttatca
agggaagaacaagatgaatttgcaatcagttcttataaaaaaacctcttcagcccatgag
aaaggaatcttcaaaaaagagattgtaccggtatcagttcctcaaagaagaggcaaacca
gatattgttgttgaagaagatgaagagtttaagaaagtcaactttgataaattcaatcaa
ttgaagccagtttttcagagagatggaggaacaatcacagcagcaaatgccagtacattg
aatgatggtgctgctgcggttgtcttgatgactgctaaaattgcagaaaaaatgggagtc
aaacctttagcaagaattattggattctgtgatgctgctgttgcccctattgacttccca
gttgctcctgcagaagcaatgccaaagttattaaagttaactggattgaagaaagaggat
attacaatgtgggaaataaatgaagcattcagtgctgttgttcttgctaatatcaagata
atgggtttggatcctgataaagtgaacataaatggaggtgctgtgtcacttggacatcct
attggaatgtctggagcgagacttgttggtcatatgacacaccatctaaatcctggtgaa
aaaggcttggccagtatttgtaatggtggaggtggcgccgcagcaattgtcattgaaaga
ctttaa

DBGET integrated database retrieval system