KEGG   Debaryomyces hansenii: DEHA2B06050gHelp
Entry
DEHA2B06050g      CDS       T01026                                 

Definition
(RefSeq) DEHA2B06050p
  KO
K09568  FK506-binding protein 1 [EC:5.2.1.8]
Organism
dha  Debaryomyces hansenii
Brite
KEGG Orthology (KO) [BR:dha00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dha03110]
    DEHA2B06050g
Enzymes [BR:dha01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     DEHA2B06050g
Chaperones and folding catalysts [BR:dha03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    DEHA2B06050g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-GeneID: 2913415
NCBI-ProteinID: XP_457224
UniProt: Q6BX45
Position
B:complement(492759..493220)
Genome map
AA seq 153 aa AA seqDB search
MFVCRPSSLNFIKQTVGYPKFNTRFSTSYLNQARSLSNSLKMSAPATTQVEILQEGDGKT
FPKPGDLVTIHYTGTLENGKKFDSSRDRGKPFQCTIGVGQVIVGWDTGIPKLSVGSRAKL
SIPGHEAYGDRGFPGLIPPNATLLFDVELLNVN
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtttgtcgtccttctagtttaaattttatcaaacaaaccgttggatatcctaaa
tttaatactagattttctacgagttacttaaatcaagctagatctttatccaattcgtta
aaaatgtccgctcctgctactactcaagttgaaattttgcaagaaggtgatggaaagacc
ttcccaaagccaggtgatttagtcaccattcactacaccggtaccttagaaaacggtaag
aagtttgactcttcgcgtgacagaggtaagccattccaatgcacaattggtgttggtcaa
gtaattgttggatgggacactggtatccctaaattgtcggttggatctcgtgctaagttg
tcgattccaggccatgaggcttacggcgacagaggattcccaggtttgattccacctaac
gctactttgctcttcgacgttgaattgttgaacgtcaattag

DBGET integrated database retrieval system