KEGG   Debaryomyces hansenii: DEHA2C12650gHelp
Entry
DEHA2C12650g      CDS       T01026                                 

Definition
(RefSeq) DEHA2C12650p
  KO
K12862  pleiotropic regulator 1
Organism
dha  Debaryomyces hansenii
Pathway
dha03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:dha00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    DEHA2C12650g
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dha03041]
    DEHA2C12650g
   03400 DNA repair and recombination proteins [BR:dha03400]
    DEHA2C12650g
Spliceosome [BR:dha03041]
 Complex B
  Other components
   Prp19 complex
    DEHA2C12650g
 Complex C
   Prp19-CDC5 complex
    DEHA2C12650g
DNA repair and recombination proteins [BR:dha03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   PSO4 complex
    DEHA2C12650g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40 Nucleoporin_N ANAPC4_WD40 WD40_like
Motif
Other DBs
NCBI-GeneID: 2899988
NCBI-ProteinID: XP_458225
UniProt: Q6BU94
Position
C:complement(1106782..1108035)
Genome map
AA seq 417 aa AA seqDB search
MNFNIIIKIICENIQLAPIINMVSYKELFNINDTDLIVPSDTLSEAVYDNSKLDYIFQNV
NRRNRDEVEDESINIQTQLPKQQNQQISKDMSEVGSKQVSEIRPDSDSRWKLLRVMAGAH
QGWVRSCTVDPVTNKWFVTGSSDSTIKIWDLASSNLKATITGHIMGVRSLAVSSRYPYLF
SGSEDKTVKCWDLERTNSSSGCQIRNYHGHVGGIYAMALHPELDLLFTGGRDSVIRVWDL
RSRTEIMVLSGHRSDITSIASQIGDPQIITSSMDATIRLWDIRKATTQLALTHHSKSIRS
MAMHPQEMTMCSGDTSGNLKEWLLPGGELLNEFGHSGENKIINTLSINPSNNTLFSGYDD
GRMEFYDYVSGDLLQSDATTPVTGSTESAIYASTFDMSGLRLITCEGDKSIKIWGEE
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcaatatcattatcaaaataatttgtgaaaatatccagctagctcctataatt
aatatggtttcatacaaagaactattcaatattaatgatacggatctaatcgtaccgtct
gacacattaagtgaagctgtatatgataattccaaattagattacatttttcaaaatgtt
aatagaagaaacagagatgaggttgaagatgagagcataaatatccaaacacaattacct
aaacaacaaaatcaacagatttcgaaagacatgagcgaagtaggctccaagcaagtttca
gaaattagacctgattcagattcacgatggaaattattaagagtaatggcaggtgcacat
caaggttgggttcgatcttgtactgttgatcctgtaacaaacaaatggtttgtaactggt
tcgtctgactctacaataaaaatatgggatttagcgagtctgaatttgaaagctacgata
acagggcatataatgggagtgaggtcattggcggtttcttctagatatccatatcttttt
tcaggatccgaagataaaactgtgaaatgttgggacttggagagaacaaactcactgctg
ggatgtcaaattcgaaattatcatggacatgttggaggtatatatgctatggcgttacat
ccagaacttgacttgttatttactggaggtcgtgactcagttattcgagtttgggatcta
aggtcaagaactgaaattatggttctaagtggccatcgaagcgatataacatctatcgca
agtcaaatcggtgatccccaaataataacaagctcaatggatgcaaccattagattatgg
gatattcgtaaagcaaccacacaactagcactaactcatcatagcaaaagtataaggctg
atggctatgcatccacaagaaatgacaatgtgttcaggggatacatctgggaacctaaag
gaatggttattaccaggcggtgaattgttaaatgaatttgggcatagtggagaaaataaa
ataataaacacgttatctattaacccaagtaataatactctattttcaggatacgatgat
ggaagaatggaattctatgattatgttagtggagatttactacaatcagatgcaactacc
ccagttactggatctactgagtctgccatatatgcatcaacatttgatatgctgggtttg
agattaataacatgtgaaggtgacaagagtatcaaaatatggggagaagaatag

DBGET integrated database retrieval system