KEGG   Debaryomyces hansenii: DEHA2D16764gHelp
Entry
DEHA2D16764g      CDS       T01026                                 

Definition
(RefSeq) DEHA2D16764p
  KO
K14642  golgi apyrase [EC:3.6.1.5]
Organism
dha  Debaryomyces hansenii
Pathway
dha00230  Purine metabolism
dha00240  Pyrimidine metabolism
dha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dha00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    DEHA2D16764g
   00240 Pyrimidine metabolism
    DEHA2D16764g
Enzymes [BR:dha01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.5  apyrase
     DEHA2D16764g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDA1_CD39
Motif
Other DBs
NCBI-GeneID: 2901616
NCBI-ProteinID: XP_459215
UniProt: Q6BRF5
Position
D:1397357..1399405
Genome map
AA seq 682 aa AA seqDB search
MKIPDTSPTYNYGIVVDSGSSGSRVQIYRWEDPNYTKKHGKEEDILTSPPKIVQEKDWTL
KTSPGISSFDEKNKVKDIWPKHFAKLMKYAEDIIPSDKHSDTPVFVLATAGMRLLSPAKK
KMILKETCSALQKNTNFYLPNCKNFIQIIDGETEGIYGWLSLNYLMGQFDKYKGTENVHK
SIGFMDMGGASTQIAFVPSSKEEIKKHEEDLSKVILRNINGESQKWNVFSETWLGFGANE
SRKRYLNQLINLSISNPNLGAEINDPCLPKDAEVSYEHEKVTYTIKGIGNYEMCLKTIYP
LLMKNVPCKDEPCLFNGIHGPQLNFKDDKFVGISEYWYTANDIFQSGGEYNYLSFNEKVR
GYCESNWNDILANSEKGDYSNLNPDKFLKDACFKASWVINILHEGFGLPRLGLEVPKEEA
DEKEAEEIKKIDKVHVPFKSADSVNGGELSWTLGKILLFASSQIESTTDNNDLQIGIYPS
EISGKDFVTGSGTLADTYDSDKDEDDLDGNVIYSIIFIFLLFFFVYHFGKKHMKWAHGFG
RFELSPQSVKSFINEMGSRLPGVNKYFSNDAIYSDFSNQNDININLEEGMISSATTPKNM
PDLSVLRTRSTMNLSEIDKSEDRMDSDSIHSGPTNFMNKPFSLPKKNQGNLFQYGDNRSW
DSLVRTSSNSSIQRAKNFERSK
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcctgacacgtctcctacctataattatgggatagttgtagattctggatcc
tcgggatctagagttcaaatatatcgatgggaagatccaaattatactaagaagcatggt
aaagaagaagatattttaacatcaccacctaagatagttcaagaaaaggattggacactc
aagactagcccaggaatttcttcttttgatgaaaagaataaggttaaagacatttggccc
aaacattttgctaaactaatgaaatatgctgaagatattattcctctggataaacatagt
gatacaccagtatttgttttagccactgcaggtatgagactattgtctcctgctaagaag
aagatgatattgaaggagacctgttctgccttacagaaaaataccaacttttatttgcca
aattgcaaaaacttcattcaaatcatcgatggagaaactgaaggcatatacggctggctt
agtttaaattacctaatgggccagtttgataaatacaagggcactgaaaatgtacataaa
tcgatagggtttatggatatgggtggggcttcaacccaaatagcgtttgtaccttcatca
aaggaagagataaaaaaacacgaagaagatttatctaaagtgatattgagaaatatcaat
ggagaaagccagaaatggaatgttttttctgaaacatggttggggtttggtgctaatgag
tcccgtaaaagatatttgaaccaattgataaatttatctatttcaaaccctaatttaggg
gctgaaataaatgatccttgtttgcctaaagacgcagaagtgagttatgaacacgagaaa
gtaacgtacactattaaaggtattggaaattatgaaatgtgcttaaagactatctatcca
ttgcttatgaaaaatgttccatgtaaagatgaaccatgcttatttaatggaattcatggg
cctcagttgaattttaaagatgataaattcgtaggtatctcagaatattggtataccgcc
aatgatattttccaaagcggtggtgaatataactatctcagttttaatgagaaggtacgt
ggatactgtgaaagtaattggaacgacatattggctaattcagaaaagggcgattactca
aatttaaatccagataagtttttaaaagatgcgtgctttaaagcaagttgggtgattaac
attttgcatgaaggctttggattaccaagacttggacttgaagttcctaaagaagaggcc
gatgaaaaggaggcagaagaaatcaaaaagatagataaagtacatgttcctttcaagtcg
gctgattcagtaaatggcggcgaattatcatggacacttggtaaaatactattatttgcc
tccagtcaaatagaatcaacgacagacaataatgatttacaaattggcatatacccaagt
gaaatttctggtaaggattttgtaacagggtcggggactttagctgatacctatgatagc
gataaagatgaagatgatttagacggtaatgttatttattcgataatattcattttctta
ttatttttctttgtttatcattttggtaagaagcacatgaaatgggctcatggcttcggt
cgatttgaattatcacctcaatcagtgaaactgttcatcaatgaaatgggatctagacta
cctggtgttaataagtatttctcaaatgatgcgatttacctggattttctgaaccagaat
gatattaatataaatcttgaggaagggatgatttccagtgcaacaactccaaagaatatg
cccgacctatcggtattaaggactagatcaacgatgaatttatctgagatagacaaatca
gaagataggatggatagtgactcaatacattctggtcctacaaactttatgaataagcct
ttttctttgcctaaaaaaaatcaaggaaatctatttcaatatggagataataggagttgg
gattcattagttaggacttcaagtaatagttctatacagagggcaaaaaattttgagaga
agcaaatag

DBGET integrated database retrieval system