KEGG   Debaryomyces hansenii: DEHA2E06600gHelp
Entry
DEHA2E06600g      CDS       T01026                                 

Definition
(RefSeq) DEHA2E06600p
  KO
K00600  glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
dha  Debaryomyces hansenii
Pathway
dha00260  Glycine, serine and threonine metabolism
dha00460  Cyanoamino acid metabolism
dha00630  Glyoxylate and dicarboxylate metabolism
dha00670  One carbon pool by folate
dha00680  Methane metabolism
dha01100  Metabolic pathways
dha01110  Biosynthesis of secondary metabolites
dha01130  Biosynthesis of antibiotics
dha01200  Carbon metabolism
dha01230  Biosynthesis of amino acids
Module
dha_M00141  C1-unit interconversion, eukaryotes
Brite
KEGG Orthology (KO) [BR:dha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    DEHA2E06600g
  09102 Energy metabolism
   00680 Methane metabolism
    DEHA2E06600g
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DEHA2E06600g
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    DEHA2E06600g
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    DEHA2E06600g
Enzymes [BR:dha01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     DEHA2E06600g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SHMT Aminotran_1_2 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP Cut12 DUF4559
Motif
Other DBs
NCBI-GeneID: 2902856
NCBI-ProteinID: XP_459594
UniProt: Q6BQC6
Position
E:complement(526595..528007)
Genome map
AA seq 470 aa AA seqDB search
MPYALSESHKQLVEGHLKDIDPEVDQIIKDEVDRQKHSIVLIASENFTSTAVFDALGTPM
CNKYSEGYPGARYYGGNEQIDKMEILCQERALKTFNATSDKWGVNVQTLSGSPANLQVYQ
ALMKPHERLMGLDLPHGGHLSHGYQTDSRKISAVSTYFETMPYRVNLDTGLIDYDMLEKT
AVLFRPKILVAGTSAYCRLIDYKKMREIADKVGAYLVVDMAHISGLVAAGVIPSPFEYAD
VVTTTTHKSLRGPRGAMIFFRRGVRSINPKTGQEILYDLENPINFSVFPGHQGGPHNHTI
AALATALKQAATPEFKQYQEQVLKNSKVLEEEFTKKGYTLVSNGTDSHMVLVSLKDKQID
GARVETICEKINIALNKNSIPGDKSALVPGGVRIGAPAMTTRGLGEEDFKKIVSYIDFAV
NYAKEIQANLPKDANKLKDFKNKVLNTEDEKLQAAKKEISQWAGEFPLSV
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgccatacgcattatctgaatctcacaagcaattggtcgaaggacacttgaaggacatt
gatcctgaagttgatcaaattatcaaggatgaagtcgatagacaaaaacattccatcgtt
ttaattgcctctgaaaattttacttcaactgctgttttcgatgccttgggaactccaatg
tgtaacaagtactctgaaggttaccctggtgctagatactacggtggtaatgagcaaatc
gacaagatggaaattttgtgccaagaaagagctttgaagaccttcaatgctacttctgat
aaatggggtgttaatgtccaaaccttatctggttcccctgctaatttgcaagtgtaccaa
gctttgatgaagcctcatgaaagattaatgggattggatttacctcatggaggtcactta
tctcacggttatcaaaccgactctagaaagatttcagctgtttcaacctactttgaaact
atgccttacagagttaacttagataccggtttaattgactacgatatgttagaaaaaact
gctgttttattcagaccaaaaattttagttgcaggtacttcagcttactgtcgtcttatc
gattacaagaagatgagggaaattgccgacaaggttggtgcttatcttgttgttgatatg
gcgcatatttccggtttagttgctgccggtgtaattccttcaccattcgaatatgctgat
gttgtcactaccactacccataagtctttaagaggtccaagaggtgctatgatcttcttc
agaagaggtgttaggtctatcaacccaaagaccggtcaagagatcttatacgacttagaa
aacccaattaacttctctgtcttcccaggtcaccaaggtggtcctcacaaccacaccatc
gcagctttagccactgctttgaagcaagcggccactcctgaattcaagcaatatcaagag
caagtattgaagaattcgaaggtcttagaagaagaattcacgaaaaagggttataccttg
gtttccaatggtaccgattcccatatggttttagtttccttaaaggataaacaaattgat
ggtgccagagtcgagactatttgtgaaaagatcaacattgctttaaataagaattctatt
ccaggtgataagtcagcattagtcccaggtggtgttagaattggtgctccagctatgacc
accagaggtttaggtgaagaagacttcaagaagattgtttcttatattgattttgctgtc
aattacgctaaggaaatacaagctaatttaccaaaggatgctaacaagttgaaagatttc
aaaaacaaggtcttgaatactgaagatgagaaattacaagctgctaagaaggaaatttcc
caatgggctggtgaattcccattatcagtctaa

DBGET integrated database retrieval system