KEGG   Debaryomyces hansenii: DEHA2F01100gHelp
Entry
DEHA2F01100g      CDS       T01026                                 

Definition
(RefSeq) DEHA2F01100p
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
dha  Debaryomyces hansenii
Pathway
dha00010  Glycolysis / Gluconeogenesis
dha00030  Pentose phosphate pathway
dha00051  Fructose and mannose metabolism
dha00680  Methane metabolism
dha01100  Metabolic pathways
dha01110  Biosynthesis of secondary metabolites
dha01130  Biosynthesis of antibiotics
dha01200  Carbon metabolism
Module
dha_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
dha_M00344  Formaldehyde assimilation, xylulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:dha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DEHA2F01100g
   00030 Pentose phosphate pathway
    DEHA2F01100g
   00051 Fructose and mannose metabolism
    DEHA2F01100g
  09102 Energy metabolism
   00680 Methane metabolism
    DEHA2F01100g
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dha04147]
    DEHA2F01100g
Enzymes [BR:dha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     DEHA2F01100g
Exosome [BR:dha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DEHA2F01100g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase Inositol_P
Motif
Other DBs
NCBI-GeneID: 2903810
NCBI-ProteinID: XP_460410
UniProt: Q6BN10
Position
F:complement(98790..99815)
Genome map
AA seq 341 aa AA seqDB search
MSTQHNSVSEQMNVDTDIITLTRFILQEQQKEAPNATGELSLLLNSLQFAFKFIAHNIRR
AELVNLIGISGSANSTGDVQKKLDVIGDEIFINAMKSSNNVKVLVSEEQEDLIVFEGGGR
YAVCTDPIDGSSNIDAGVSVGTIFGIYRLKEDSQGSIKDVLRKGTEMVAAGYTMYGASAH
LMLTTGQGVNGFTLDTQLGEFILTQPHLTIPKTRAIYSVNEGNSHYWADSAKQYIADLKK
PQEDGKPYSARYIGSMVADIHRTILYGGIFAYPADSKSKNGKLRILYECFPMAMLMEQAG
GAAINDKGERILEILPKGIHDKSGIWLGSTGEVDRYLTYLK
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtccacacaacacaattcagtctctgaacagatgaacgtcgacaccgacatcatcacg
ttgaccagatttattttgcaagaacagcaaaaagaagccccaaatgctactggtgaattg
tcattgttattaaactcgttacaatttgctttcaaattcattgctcacaacattagaaga
gccgaattggtcaatttgattggtatcagtggtagtgctaactctactggtgatgttcaa
aagaaattggatgtgattggagatgaaattttcatcaatgctatgaaatcgtcgaacaac
gtcaaagttttagtttcagaggaacaagaagacttgattgttttcgaaggaggtggacgt
tatgctgtttgtaccgatccaattgacggatcgtctaatattgatgctggtgtttctgtt
ggtactatcttcggtatctatagattgaaggaagattctcagggatccatcaaggatgtg
ttgagaaagggtaccgaaatggttgctgctggttacactatgtacggtgcttctgctcac
ttaatgttgaccacaggacaaggtgtcaacggcttcactttggatacacaattgggtgaa
ttcattttgactcaaccacacttgaccattcctaagaccagagctatttactctgtcaac
gaaggtaactctcattactgggctgacagtgccaaacaatatatcgcagacttgaagaag
ccacaagaagatggaaagccttacagtgcaagatacattggttctatggttgctgatatt
cacagaactatattgtacggtggtattttcgcatatccagctgattctaagctgaaaaat
ggtaagttaagaattttatatgaatgtttcccaatggctatgttgatggaacaagccggt
ggtgcagccattaacgataagggtgaaagaatcttagaaattttgccaaaaggaatccat
gacaagagtggtatctggttaggctcaaccggtgaagttgatagatacttaacttacctc
aaataa

DBGET integrated database retrieval system