KEGG   Debaryomyces hansenii: DEHA2F08976gHelp
Entry
DEHA2F08976g      CDS       T01026                                 

Definition
(RefSeq) DEHA2F08976p
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
dha  Debaryomyces hansenii
Pathway
dha00670  One carbon pool by folate
dha01100  Metabolic pathways
dha01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dha00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    DEHA2F08976g
Enzymes [BR:dha01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     DEHA2F08976g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-GeneID: 2903768
NCBI-ProteinID: XP_460752
UniProt: Q6BM19
Position
F:complement(770497..772425)
Genome map
AA seq 642 aa AA seqDB search
MPTVKDRVQALKPHERFVSFEFFPPKTDTGFRNLLARLNRMSALNPLFITVTWGAGGSTS
EKSLDLAATCQKEIGLTTVLHLTCTNTNKEIIDNALEKAKEQGIRNILALRGDPPRTEEY
WIPDCDFNNAVDLVKYIKQQYGDYFCIGVAGYPEGHVDGSDSSNQDPRNDMPYLVEKVEA
GADYIITQLFFDVDKFLNYEAMIRSYPQLKDIILIPGLMPITTYKVFTRATKLSHASIPL
EIQSSLHSSSYDDDLVKNIGIDVINNIINKIDSNTDNRIKGYHFYCLNLEKAVASIINDS
DVLKSVMDLPDETNNNEDAIASDSDEDLPAVTISNRRRKSSIINDNELADKSNAQKSLVG
KALIGDKRTLVDISTGKGALGKDATWDDFPNGRFGDSNSPAYGEIDGYGPTLKIYSPEEA
IHKWGAPESVNEIIKVFVSYLSGKIDSLPWVDAALSPETALIQEELFEVNNKGWFSLASQ
PAVNGCLSSDKIFGWGPGNGIIYQKAFIEIFIPKDTWTNKLLPGLQKYLDDQTITYYCGD
AEGRLTSNLNIDQEHYNSKNAITWGVFPSKEVLQPTIIDLESFKAWNEEAFILWLEWARC
YKKTSKTYELLNSIYKDYYLVSLISHDFKDEYALWNILLENK
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgccaacagttaaagatagagttcaggcattgaagccacatgagaggtttgtctctttt
gaattttttccaccgaaaactgatactgggtttcgtaatttgttagctagattgaatcgt
atgctggcattaaatccattattcatcactgttacctggggagcaggtggatctaccagc
gaaaagtcgctagacttggcagccacatgtcaaaaagagataggattaacaactgtgtta
catttgacatgcaccaatacaaataaggagatcattgacaatgcgttggaaaaggccaaa
gagcagggcataaggaacattcttgctttgagaggtgatcctcctagaacggaggaatat
tggattccagactgtgattttaacaacgcagtggatttagtcaagtacattaaacagcaa
tatggagactacttctgtattggtgttgcgggataccccgaaggacatgttgatggttcg
gatagctcgaaccaggatccgcgtaatgatatgccatatttagttgagaaagttgaagcc
ggtgccgactatattataacacaattattctttgatgttgacaaatttcttaactacgaa
gctatgataagatcatatccacaattaaaggatataattttaattccaggtttaatgcct
atcaccacatacaaagtattcactagagctacaaaattatcccatgcatcaatcccgttg
gaaattcaatctagtttacactcgtccagttatgatgatgatctagtgaagaacattggt
attgacgttattaataacatcattaataaaatagattctaataccgataaccgtattaaa
ggatatcatttctactgtcttaatttagaaaaggcggtggcgtctatcataaatgattcc
gacgtattgaaatcagttatggacctaccagatgaaaccaacaataatgaagatgcaatt
gcatcagattcagacgaggatcttccagctgtaacaatttcgaatagaagaaggaagtct
tctattattaatgataacgaattggcagataaatcaaatgcacaaaaaagtcttgttggc
aaggcattgattggagataagagaaccttagtggatattagtaccggtaaaggtgcgcta
ggtaaagacgctacatgggatgatttcccgaatggtagatttggtgattctaattctcca
gcctatggtgaaatcgatggttacggcccaactttgaaaatttattctccagaggaggct
attcacaaatggggtgcaccagaatcagtcaatgaaattattaaggtatttgtcagctat
ttatccggaaaaattgattcattaccttgggtcgatgcagccttatcaccagaaacagct
ttaatccaagaggaattatttgaagtaaataataaaggatggttttcattggcctcacaa
ccagccgttaatggttgtttatcctctgataaaatctttggttggggaccaggcaatggt
atcatttaccaaaaggcatttattgaaattttcattcctaaagatacgtggactaataaa
ttattaccaggattacaaaaatatttagatgatcaaacaattacctattattgtggtgat
gcagaaggtcgtcttacatccaacctaaacattgaccaagagcattacaatagcaaaaat
gccattacatggggtgtttttcctctgaaagaagtgttgcaacctacaataattgacctt
gagtcttttaaggcttggaatgaagaagcttttatattatggctagaatgggctagatgt
tataagaaaacttcaaagacatatgaattattgaattctatttacaaggattactattta
gttagtttgatttcacatgattttaaagatgaatatgctttatggaacatcttattagaa
aacaaatga

DBGET integrated database retrieval system