KEGG   Debaryomyces hansenii: DEHA2F09526g
Entry
DEHA2F09526g      CDS       T01026                                 

Definition
(RefSeq) DEHA2F09526p
  KO
K23856  peroxiredoxin [EC:1.11.1.24]
Organism
dha  Debaryomyces hansenii
Brite
KEGG Orthology (KO) [BR:dha00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DEHA2F09526g
Enzymes [BR:dha01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.24  thioredoxin-dependent peroxiredoxin
     DEHA2F09526g
SSDB
Motif
Pfam: GSHPx AhpC-TSA Redoxin DUF4174
Other DBs
NCBI-GeneID: 2903617
NCBI-ProteinID: XP_460775
UniProt: Q6BLZ6
Position
F:818927..819409
AA seq 160 aa
MSFYDLSPLDTNDKPFPFEELKGKVVLVVNVASKCGFTPQYKELEELNKKYQDKGLQIIG
FPCNQFGGQEPGSSEEIASFCSLNYGVSFPVLKKVDVNGDKTDPVYKYLKGEKSGLLGLN
RIKWNFEKFLIDKNGKVIERYSSLTKPASLSSTIEELLKK
NT seq 483 nt   +upstreamnt  +downstreamnt
atgtctttttacgatttaagtcctcttgatacaaacgacaagccattcccatttgaagaa
ttaaagggtaaagttgtgttggtggtcaatgttgcatctaagtgtggtttcacaccacaa
tacaaggaattagaagaactcaacaaaaaatatcaggataaaggattacagattattggt
ttcccatgtaaccaattcggaggacaagaaccgggcagttctgaagaaattgctagcttc
tgttctctcaactacggagtgtcattcccagtgttgaagaaagtcgatgtcaatggggac
aagactgacccagtttacaagtatttgaagggggaaaagctgggattactcgggttgaac
agaattaagtggaactttgaaaaattcttgattgacaagaacgggaaggttattgaacgt
tattcgtcattgaccaagcctgcttctctcctgtctacaatcgaggagttattgaagaaa
tag

DBGET integrated database retrieval system