KEGG   Debaryomyces hansenii: DEHA2F16896gHelp
Entry
DEHA2F16896g      CDS       T01026                                 

Definition
(RefSeq) DEHA2F16896p
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
dha  Debaryomyces hansenii
Pathway
dha00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:dha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    DEHA2F16896g
Enzymes [BR:dha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     DEHA2F16896g
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     DEHA2F16896g
    1.1.1.-  
     DEHA2F16896g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc
Motif
Other DBs
NCBI-GeneID: 2903111
NCBI-ProteinID: XP_461095
UniProt: Q6BL26
Position
F:1437970..1439127
Genome map
AA seq 385 aa AA seqDB search
MKAIVYHGNKDIRYTDSHPSPNITHETEVKIKVDFCGICGSDLHEYLDGPIFFQGEKSEI
SNISKVQCMGHEISGEVVEIGSEVKALKVGEKVVVEASGTCLDRYRFPDAPNVKKPNCCA
CHDDHRNACDHIGFVGLGFMDGGFSDYCIVGQEHVVPYPEDLIPADVAAITEPLSVAWHA
VRTSNFQPGQSALVLGSGPIGLAAIIALKGHKAGKIVVSEPALSRRVLAQDFGAEVIDPK
DYSYEECIKALKLMTVDGFGFHHSYDCSGIAATFNASVHSLRTFGTATNIAIWPHKPIDF
YPMDVTFKEKVITGSMCTTRLDFEQVIDAYKKGLIDPNEVKRFITSRIHLEDGIEKGFME
LINNKDKHIKILMTPNEQFKRTSLT
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccatagtttaccacggtaataaggatattagatacactgattcacatccttca
cctaatattacccacgaaactgaggtgaagattaaggtcgacttttgcgggatttgtggc
tcggacttacatgaatacttggacggacccattttttttcaaggcgaaaagagtgaaatt
tcgaatatcagcaaggtgcagtgtatgggtcatgagattagtggagaggtggtagagatt
ggctctgaagtcaaagctttgaaagtaggagaaaaagtggtagtggaagcaagtgggact
tgtctagatagatatagatttccggacgcacccaatgtaaagaagccaaattgttgtgcg
tgccatgacgaccatcgtaatgcatgcgaccacattggatttgttggattggggtttatg
gatggagggttttcggattactgcattgtggggcaagaacatgttgttccatatccagaa
gacctaattcctgctgatgttgcagccatcacggaaccattatctgtagcttggcacgct
gtgagaacatctaattttcaaccggggcaactggcattagtcttgggtagcggacctatt
gggttggcagctattattgcacttaagggtcataaagcagggaaaatagtcgtcagcgaa
ccagcattaagcaggcgagtgctagctcaagattttggtgctgaggttatagatccaaag
gattactcatacgaggaatgtatcaaagccttgaaattgatgacagttgatggatttggg
ttccatcacagttatgattgttctggaattgctgcaacttttaatgcgtcggtgcattca
ttaaggacatttggcactgcaaccaacattgctatctggccacataaaccaattgacttt
tatcctatggatgtaactttcaaagaaaaggttattacgggatcgatgtgtactactcga
ctcgactttgaacaagtaattgatgcttataaaaaagggttaattgatcctaacgaagtc
aaaaggtttattactagtaggatccatttagaagatggtattgagaagggctttatggaa
ttgattaataacaaagataaacatatcaagatattaatgactccgaacgaacaatttaaa
agaacaagcctcacttaa

DBGET integrated database retrieval system