KEGG   Debaryomyces hansenii: DEHA2F18700g
Entry
DEHA2F18700g      CDS       T01026                                 

Definition
(RefSeq) DEHA2F18700p
  KO
K17292  tubulin-specific chaperone A
Organism
dha  Debaryomyces hansenii
Brite
KEGG Orthology (KO) [BR:dha00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dha04812]
    DEHA2F18700g
   04147 Exosome [BR:dha04147]
    DEHA2F18700g
Cytoskeleton proteins [BR:dha04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Others
     DEHA2F18700g
Exosome [BR:dha04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   DEHA2F18700g
SSDB
Motif
Pfam: TBCA TubC_N WHEP-TRS KASH_CCD U3_snoRNA_assoc HTH_Tnp_Tc3_1
Other DBs
NCBI-GeneID: 2904320
NCBI-ProteinID: XP_461158
UniProt: Q6BKW3
Position
F:complement(1570448..1570747)
AA seq 99 aa
MSPSSLQIKVNSLKRLIKEESLYQQEVAEQQHFVNQMKSNNADEYELKKQIQVLEESQRM
VPEVSEKIKKHKQALIEYVENYKGDEDLSAAKELISAEV
NT seq 300 nt   +upstreamnt  +downstreamnt
atgtctccaagtagtttacagattaaggtcaattccttgaaaagattaataaaggaagag
tcattgtaccaacaagaagttgctgaacaacagcactttgtaaatcaaatgaaatcaaat
aatgctgatgaatacgaattgaagaagcaaattcaagtgttagaagaatcccaaagaatg
gtgccagaagtttctgagaaaatcaaaaagcataagcaagcattaatagagtatgtggaa
aattataaaggtgatgaagatttaagtgctgctaaagaattaattagtgctgaagtataa

DBGET integrated database retrieval system