KEGG   Debaryomyces hansenii: DEHA2F24574gHelp
Entry
DEHA2F24574g      CDS       T01026                                 

Definition
(RefSeq) DEHA2F24574p
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
dha  Debaryomyces hansenii
Pathway
dha00520  Amino sugar and nucleotide sugar metabolism
dha01100  Metabolic pathways
dha01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    DEHA2F24574g
Enzymes [BR:dha01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     DEHA2F24574g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-GeneID: 2903852
NCBI-ProteinID: XP_461409
UniProt: Q6BK62
Position
F:complement(2034378..2035616)
Genome map
AA seq 412 aa AA seqDB search
MSFTKFTNCQLCDQGIIYYDGELYVDNSTGRIASRPEKGAKIEVVDLEGNILAPGFIDIQ
NNGIFGLNFSSLNGNSSEEDVEGFRNHYRDAMAKYLATGVTAICPTVTSNFPEVYEKVLP
VYKVSRSKVQTDSLGAHCEGPFINVQKKGCHPPETFTDAKGGYRDITKVYGENNLSEYVA
IVTAAPEIEGVLDVIAVLKEKNITVSIGHTTAGYETGLQAIENGATMVTHLYNAMPQPHH
RDVGVVGLITSPIAKDAPYFGLITDGVHVDPSMATIAYRSRPDKCIVVTDAMHLIGLPDG
TYKWDNQYITKTGPRLYLKGTKTLAGAATTLPQCMRNLMAWANISLPEAIKTVTNNPAKS
IGVEKRKGFLNVDCDADLVVLDKKGFVKNVYKLGKPIKTSDENQPSKLMAAL
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttacaaaatttaccaattgccagttatgtgaccagggtattatatactacgat
ggagagctatacgttgataattccaccggtagaattgctagtaggccggaaaaaggtgca
aaaattgaagttgttgatttggaaggtaatatactagccccagggtttattgatatccag
aacaacggaatattcgggttgaatttctcttctttgaatggaaattcgagtgaagaggat
gttgaagggttcagaaatcattatcgtgatgctatggctaaatatttagctacaggagtg
acggctatttgtcctacggtaacatcgaactttccagaggtgtatgagaaggtcttgccg
gtgtataaggtcagccgttcgaaagtgcaaacagactctcttggagcacactgtgaggga
ccatttataaatgtccagaagaaaggatgccatcctcctgagacatttacagatgccaag
gggggctacagagatatcacaaaagtgtatggcgagaacaacctttccgagtatgtggcc
atagtaaccgcagcccccgaaatcgaaggagtcttggatgtgattgcagtcttgaaagag
aagaatatcactgtatccattggccataccactgcaggctacgagacggggttgcaggca
attgaaaatggtgctaccatggtcactcatttatacaatgccatgccacaaccacatcac
cgggatgtcggggttgtggggttgataacatcgccaattgctaaggacgcgccttatttc
ggtttgataacagatggagtccatgttgacccttccatggccacaatagcatatagatcg
aggccagataagtgcatagtggtcaccgatgcaatgcatttgataggtctaccagacggg
acttacaagtgggataatcaatacataacgaagacaggccctagattatatttgaaggga
actaagactttggctggtgctgcaaccactttgcctcaatgcatgcggaatttgatggcc
tgggccaatatttcgcttccagaagcaattaaaacggttactaataatccagccaagtca
atcggtgtagagaaaaggaagggcttcttaaatgtagactgtgatgccgatttggtcgtt
ttagacaaaaaagggtttgtaaagaatgtctataaattgggcaaaccaattaaaacatca
gacgagaaccagccttccaagttaatggctgcattataa

DBGET integrated database retrieval system