KEGG   Debaryomyces hansenii: DEHA2F26818gHelp
Entry
DEHA2F26818g      CDS       T01026                                 

Definition
(RefSeq) DEHA2F26818p
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
dha  Debaryomyces hansenii
Pathway
dha00052  Galactose metabolism
dha00500  Starch and sucrose metabolism
dha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    DEHA2F26818g
   00500 Starch and sucrose metabolism
    DEHA2F26818g
Enzymes [BR:dha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     DEHA2F26818g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 2903733
NCBI-ProteinID: XP_461505
UniProt: Q6BJW6
Position
F:complement(2239579..2241183)
Genome map
AA seq 534 aa AA seqDB search
MKITTLVASILMSVLLEPVIASFIDTGKDTSAYNRPLIHLTPNVGWLNDPNGLFYDKKTS
VWHAYYQYNPNDTIWGQPLYWGHSSSKDLTHWEEHQVALGPQNDDEGIFSGSIVIDYNNT
SGFFDESIDKDQRVVAIYTNSIPDTQTQDIAYSLDGGETFTKYKKNPVIDVNSTQFRDPK
VFWHEETNKWIMVVSKSQEYKIQIFGSLDLKTWDLHSNFTSGYLGNQYECPGLIKVPIEN
TNDYKWVMFLAINPGSPAGGSSNQYFIGEFDGFEFKQDDSITRVMDAGKDFYAFQTFSDN
EQDVIGLAWASNWQYANVVPTNPWRSSMSLARKYTLGYVNQNVETKIMTLIQTPILNNLD
VINKVEKNNHLLTKNDSVITNFSSSTGLLDFNTTFKVVGESIDSNSLSNIEILIHSQMSN
SSTESIKVGFDRSVSAFYFNRDIPNVEFNNNPYFTNKFSTYVEPSHYDEDDMPVYKIYGI
VDKNILELYFNDGTQTMTNTFFMSEDKYPHQIEIASNVDGQFELQSLLIRELNN
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcactactttagttgcttctattttgatgagtgttcttttagaaccagtgatt
gcttcgtttatcgatacaggcaaggatacgtctgcatataacaggcctttaattcatttg
acaccaaatgttggatggttgaatgatccgaacggtttattttacgataagaaaaccagt
gtttggcatgcatactaccaatacaatccaaacgacacaatatgggggcagccattatac
tgggggcattctagttctaaggatttgacacattgggaagaacatcaggttgcacttggt
cctcaaaatgatgatgaaggaattttctctgggagtattgtgattgattacaacaatacg
tctggtttttttgatgaatctattgataaggatcaaagggtcgttgcaatttataccaat
tccattccggacacccaaactcaagacatcgcctattctttagatggaggagaaaccttt
actaaatacaaaaaaaatccagtcatagacgtaaattctactcagttccgtgacccaaag
gttttctggcacgaggaaacaaataaatggatcatggtcgttctgaagtctcaagaatat
aaaatccagatatttggttctcttgatttaaagacctgggatttacattcgaattttaca
tcgggttatttaggtaatcaatatgaatgtccaggattaattaaggttccaatagagaat
acgaatgattacaaatgggttatgtttttggcaattaacccaggttctccagctggtgga
tctagcaaccaatatttcattggggagtttgatggttttgaatttaaacaagatgattcg
attactagggtaatggatgctggtaaagatttttacgctttccaaacatttagtgataac
gagcaagatgtaatcggtttagcatgggcatctaattggcaatatgccaatgttgtacca
actaatccttggagaagttcaatgtctttggctagaaagtatactttgggctatgtcaat
caaaacgtcgagaccaaaataatgacattaatacaaacccctattttaaataatcttgac
gttataaacaaagtcgagaaaaacaatcatttgttgactaagaatgattcggttattacg
aactttagctcttctacaggtttacttgattttaataccacgtttaaggttgtcggagag
agcatcgatagcaactcactctccaatatagagattttgattcattcccagatgtcgaat
tcgagtactgaatcgataaaagtgggatttgacagaagtgtatctgcgttctattttaat
cgtgatattccaaatgttgaattcaataacaacccttatttcactaacaagttctcaact
tacgtcgagccatcacattatgatgaagatgatatgccagtttataagatctacggaatc
gtcgacaaaaatattttagagttatatttcaatgatggtactcaaaccatgacaaacacg
ttttttatgagtgaagataagtatccacatcaaattgagattgcaagtaatgtggacggt
caattcgaattgcaaagcttgttgattagagaattaaataattaa

DBGET integrated database retrieval system