KEGG   Debaryomyces hansenii: DEHA2G03476gHelp
Entry
DEHA2G03476g      CDS       T01026                                 

Definition
(RefSeq) DEHA2G03476p
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
dha  Debaryomyces hansenii
Brite
KEGG Orthology (KO) [BR:dha00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dha01009]
    DEHA2G03476g
Enzymes [BR:dha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     DEHA2G03476g
Protein phosphatases and associated proteins [BR:dha01009]
 HAD phosphatases
  Other HAD phosphatases
   DEHA2G03476g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_6 SAND
Motif
Other DBs
NCBI-GeneID: 2904565
NCBI-ProteinID: XP_461697
UniProt: Q6BJC4
Position
G:complement(join(303168..303859,303944..303972,304030..304040))
Genome map
AA seq 243 aa AA seqDB search
MTQFPKNIKACLFDMDGTILNTEDIYTECTTELLNDFGKGPLTWDVKIRLQGRPGPEAVK
IIIEEYGLSLTPEEFSQLAIKKQENKWHRSKFLPGALELLQYLYDSSIPIALGTSSNTFN
FKRKTAHLQDGFNLFGPHIVTGDDERIPPGKGKPHPDIWFACLDSLNKERQEQGLDPVLI
EECLIFEDGIPGVKSGIAANSYVIWIPDEKALKVLNGEEELVIGDSGEILKSLVHFDKSK
YSL
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgactcaatttcccaaaaacatcaaggcatgtcttttcgatatggatggaactatcctt
aatacagaagatatatatacagaatgtacgacagaattattgaatgattttggaaagggg
ccattgacatgggacgtaaagattagattacagggaagacctggccctgaggccgttaaa
attatcattgaagagtatggtttatcgctcactcctgaagaattttctcaattagccatt
aaaaaacaagagaacaagtggcatcgttccaaattcttaccgggtgcgttagaattgtta
caatatttatatgatagttcaattcctattgctcttggaaccagttctaatactttcaat
tttaaaagaaagacggcacatttgcaggatggttttaatctatttggtccgcatattgtg
actggagatgatgagagaattccacctggaaaaggaaagccacaccctgatatttggttc
gcatgtttggatagtctcaataaagaaagacaagagcaaggtttggatcctgtcttaata
gaggaatgccttatatttgaagatggtataccaggtgtgaaatcaggtattgctgcaaac
tcgtatgtaatctggattccagatgaaaaggcactaaaagtcttaaatggagaagaagaa
cttgttattggggatagtggtgaaatattaaagagtcttgttcactttgataagtcaaag
tattctctatag

DBGET integrated database retrieval system