KEGG   Debaryomyces hansenii: DEHA2G14058gHelp
Entry
DEHA2G14058g      CDS       T01026                                 

Definition
(RefSeq) DEHA2G14058p
  KO
K01689  enolase [EC:4.2.1.11]
Organism
dha  Debaryomyces hansenii
Pathway
dha00010  Glycolysis / Gluconeogenesis
dha00680  Methane metabolism
dha01100  Metabolic pathways
dha01110  Biosynthesis of secondary metabolites
dha01130  Biosynthesis of antibiotics
dha01200  Carbon metabolism
dha01230  Biosynthesis of amino acids
dha03018  RNA degradation
Module
dha_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dha_M00002  Glycolysis, core module involving three-carbon compounds
dha_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DEHA2G14058g
  Energy metabolism
   00680 Methane metabolism
    DEHA2G14058g
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    DEHA2G14058g
Enzymes [BR:dha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     DEHA2G14058g
Messenger RNA biogenesis [BR:dha03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     DEHA2G14058g
Exosome [BR:dha04147]
 Exosomal proteins
  Proteins found in most exosomes
   DEHA2G14058g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Motif
Other DBs
NCBI-GeneID: 2905065
NCBI-ProteinID: XP_462151
UniProt: Q6BI20
Position
G:1167494..1168813
Genome map
AA seq 439 aa AA seqDB search
MAVTKLFARYVYDSRGNPTVEVDLTTDKGLFRSIVPSGASTGIHEALELRDGDKSKWLGK
GVTKAVANVNELIAPAFVKANLDVTNQSAVDDFLNKLDGTPNKSKLGANAILGVSLATAK
AAAAEKNVPLYQHLADISGSKQDKFVLPVPFQNVLNGGSHAGGALAFQEFMIVPTDAPTF
SEALRMGSEVYHNLKSLTKKKYGQSAGNVGDEGGVAPDIGSPREALDLIMDAIDKAGYKG
KIGIALDVAASEFYKDGKYDLDFKNPNSDESKWLSGEQLASLYEELINEYPIVSIEDPFG
EDDWDAWVHFYSKVSSKVQIVGDDLTVTNPLRIKTAIEKKAANALLLKVNQIGSLTESIK
AAQDSFDATWGVMVSHRSGETEDTFIADLSVGLRAGQIKTGAPARSERLAKLNQILRIEE
ELGDKAIYAGKNFHAASQL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcactaagttatttgctcgttatgtctacgattctcgtggtaacccaactgtt
gaagttgatttaaccaccgacaagggattattcagatccattgttccatctggtgcttcc
actggtatccatgaagctttggaattgagagatggtgacaagtccaaatggttaggtaag
ggtgttaccaaggctgttgccaatgttaacgaactcattgctccagctttcgtcaaggcc
aacctcgacgtcaccaaccaaagtgccgttgatgacttcttgaacaagttggacggtacc
ccaaacaagtctaagttaggtgccaatgccatcttaggtgtttctttagccactgctaag
gctgctgctgctgaaaagaacgttccattataccagcacttagctgatatttctggttcc
aagcaagacaagtttgtcttaccagttccattccaaaacgtcttgaacggtggttcccat
gctggtggtgctttagctttccaagaattcatgattgtcccaactgacgctccaaccttc
tctgaagctttgagaatgggttctgaagtctaccacaacttgaagtccttgaccaagaag
aagtacggtcaatccgctggtaacgtcggtgatgaaggtggtgttgctccagatatcggt
tctccaagagaagctttagacttgatcatggatgctattgacaaggctggttacaagggt
aagatcggtattgccttagatgttgccgcttctgaattctacaaagacggtaagtacgat
ttagacttcaagaatccaaactctgacgaatctaagtggttatctggtgaacaattagct
tccttatacgaagaattgatcaacgaatacccaattgtttctattgaagatcctttcggt
gaagatgactgggatgcttgggttcacttctactccaaggtttcttccaaggtccaaatc
gttggtgatgacttaactgtcactaacccattaagaatcaagaccgccattgaaaagaag
gccgccaacgctttgttattaaaggtcaaccaaattggttctttaactgaatccatcaag
gctgctcaagactcctttgatgctacctggggtgttatggtttcccacagatctggtgaa
accgaagataccttcattgctgatttatctgttggtttaagagctggtcaaattaagact
ggtgccccagccagatctgaaagattagccaagttaaaccaaatcttaagaatcgaagaa
gaattaggtgacaaggctatctacgctggtaagaacttccacgctgcttctcaattataa

DBGET integrated database retrieval system