KEGG   Debaryomyces hansenii: DEHA2G20262gHelp
Entry
DEHA2G20262g      CDS       T01026                                 

Definition
(RefSeq) DEHA2G20262p
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
dha  Debaryomyces hansenii
Pathway
dha00450  Selenocompound metabolism
dha00970  Aminoacyl-tRNA biosynthesis
dha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dha00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    DEHA2G20262g
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DEHA2G20262g
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dha01007]
    DEHA2G20262g
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dha03016]
    DEHA2G20262g
Enzymes [BR:dha01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     DEHA2G20262g
Amino acid related enzymes [BR:dha01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   DEHA2G20262g
Transfer RNA biogenesis [BR:dha03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    DEHA2G20262g
 Prokaryotic type
   Other AARSs
    DEHA2G20262g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 MetRS-N tRNA-synt_1e Anticodon_1 Ank_2
Motif
Other DBs
NCBI-GeneID: 8999263
NCBI-ProteinID: XP_002770677
UniProt: B5RUW5
Position
G:complement(1641899..1644166)
Genome map
AA seq 755 aa AA seqDB search
MSSLQIIGEKGSSLLTLASNLKLSLVSAIYQPKLSVSLSENESSLSLIDKKSGFELSEPN
AIVKYLANDFNKDKLLEFEETSLYKAAKSNKKDAIVQAINESSIKLEKAETSTSQIILFA
AVYGALSGGKYETPFDKWFKEFSELPKVSEAIKHALSITTLERQKSENTGAQKVKTGHLV
KKQADRILPKENERNILITSALPYVNNVPHLGNIVGSVLSADIYARYAKNRNYNALFICG
TDEYGTATETKALEEKITPKQLCDKYHKIHKDVYDWFDIGFDYFGRTTTSQQTEIAQDIF
MKLFDNGYLEEKTTEQLYCQEHNAFLADRFVEGTCPKCQYEDARGDQCDKCGSLLNPFEL
VNPRCKVDNAKPIPRNSTHIYIKLDDLEPELKAWVEEASEKGAWSKNSKTITNSWLKQGL
EPRCITRDLIWGTPVPLEKFKDKVLYVWFDATIGYVSITANYFKDNKTEDWKKWWRNPEN
VDLYQFMGKDNVPFHTVVFPASQIGTKDNWTKLHHLNTTEYLQYENGKFSKSRGVGVFGN
NAKETNISPSVWRYYLASVRPESSDSHFSWTEFVTKNNSELLANLGNFVNRLVKFVIAKY
NGVVPEFDPKNIPDYNKFNTEINQLLANYIENMEAVNLRRGLEIAMSISSRGNQFLQDNK
LDNNLYTNLPDKSDAVMGVGLNLIYLVSAIISPFMPECTTQICQVLNAPPLSITDKFELV
LEPGHCIGKAQYLFKRIDESKIDEWRSLYGGQQKA
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgcttcagataattggtgaaaagggtagctccttattaacattggccagtaat
ttgaaattatctttagtttctgctatttatcaacctaaattaagtgtttccttaagtgaa
aatgagtcatctctctcattgatcgataagaagtcaggttttgaattatcggaaccgaat
gctattgtaaaatatcttgcaaatgatttcaacaaagataagttgctcgaattcgaagaa
actagtctttacaaggctgcaaaatcaaataaaaaagatgcgattgttcaggctatcaat
gagagctctataaagcttgaaaaggccgagacttcaacgagccagattattctttttgcc
gctgtgtatggtgctttaagtggcggcaagtatgagactccatttgacaagtggtttaaa
gaatttagtgaacttccaaaggtttctgaggctattaagcatgcgttatccatcacaaca
ttagagagacaaaagagcgagaatactggagcccaaaaggtgaaaacaggtcacttagtc
aagaagcaagcggatagaattcttcctaaggagaacgaaagaaatatcttaattacgtct
gccttgccttatgttaataatgttccacatttaggtaatattgttggttcagttttatca
gcagacatttatgctcgttatgccaagaacagaaattataatgccttgttcatttgcggt
acagatgagtacggaactgctactgaaactaaagcattagaagaaaagattaccccaaaa
caattgtgtgataaataccataagattcataaggatgtttacgattggtttgatatagga
ttcgattactttggtagaactaccaccagtcagcaaactgagattgcccaagatattttt
atgaaattgtttgataatggctatttagaagagaaaaccactgaacaattgtactgtcag
gaacataatgcattcttggcagatagatttgttgaaggtacttgtcctaaatgtcaatac
gaagatgccaggggcgatcaatgtgacaaatgtggttccttattgaatccattcgaattg
gtaaaccctcgttgtaaggttgataatgctaaacctatccctagaaactccactcacatt
tacattaaattggatgatttggaaccagaacttaaagcatgggttgaagaagcgtctgaa
aagggtgcttggtctaagaattccaagaccatcactaattcatggttgaagcaaggcttg
gaaccaagatgtatcacaagagatttgatttggggtacacctgttccattggaaaaattc
aaggacaaggtcttgtatgtctggtttgatgccactatcggttatgtatctatcacagcc
aattacttcaaggacaataaaacagaggactggaagaaatggtggagaaacccagaaaat
gtcgatttataccaatttatgggtaaggataatgttccgttccatacagttgttttccca
gcttcccaaattggtaccaaagacaattggactaaattacaccacttgaacacaactgaa
tacttgcaatatgaaaatggtaagttctctaaatctagaggtgtaggtgtttttggtaat
aatgccaaggaaactaatatttctccatcagtttggaggtactacttagcctccgtgaga
cctgaatcctctgattcacacttctcttggactgaatttgttactaaaaacaactccgag
ttattagctaacttaggtaacttcgtcaatagattggtcaagtttgttattgccaaatat
aacggggttgtcccagaatttgacccaaagaacattccagactacaataaatttaatact
gaaatcaaccaattattagcaaattacattgaaaatatggaagctgttaatttacgtcgt
ggtttggaaattgctatgtctatctcatctcgtggtaaccaatttttacaagacaacaaa
ttagataataatttatataccaatttaccggacaaatctgatgctgttatgggtgttggt
ttaaatttgatttacttggttagtgctattattagtcctttcatgccagaatgtaccacc
caaatttgccaagttttgaatgctcctccattatctattactgacaagtttgagttggtt
ttagaacctggtcactgcattggtaaggcccaatacttgtttaagagaatcgatgaaagt
aaaattgacgaatggagaagcttatatggcggtcaacaaaaggcctag

DBGET integrated database retrieval system