KEGG   Debaryomyces hansenii: DEHA2G21890g
Entry
DEHA2G21890g      CDS       T01026                                 

Definition
(RefSeq) DEHA2G21890p
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
dha  Debaryomyces hansenii
Pathway
dha00910  Nitrogen metabolism
dha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dha00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    DEHA2G21890g
Enzymes [BR:dha01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     DEHA2G21890g
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Pyr_redox Rieske_2 Rieske Fer2_BFD NIR_SIR_ferr Rubredoxin_C Pyr_redox_3 AF-4_C
Other DBs
NCBI-GeneID: 2905445
NCBI-ProteinID: XP_462495
UniProt: Q6BH26
Position
G:complement(1774339..1777635)
AA seq 1098 aa
MKTSDDNISFSKGGVPPTSKEISVLKDDCNKKHIIIVGFGMVGFAFLEKMLVDDTAGEYR
LTIIGDEPHLAYNRVGLTEYFEHQDFDKLLLAPHSFYDQKNADTCEYRVNQKVTKIEKEH
KYIETSNAKRYHYDYLVLATGSYAVLPIDLFPRSQSNEFCDLKSCRKLGCFVYRTIDDLN
AMISFSETIRSTIKKPVLKRAVIVGGGLLGLEAAKALLDMECYDEVTIVHRSKWLLSQQL
DEKGGNLLTERIAEMGVKLRTDTTINKLQYDHCTSSFEVQYNNGDVEICQLLCYTIGIKP
QDILARSSGLKVAKKGGIEVDNFMKTSNRYIYAIGECASWNNQTFGLIAPGVMMADILSF
NLIQAKYHSERQFTKPDIGTRLKLMGVNVASFGDYFADKNGPSRLPKGYKIKKVKSLVYD
DPIEANYTKLLLSYDGKYLLGGILVGDTTQFTKLASITKSGKPLEKPASTFIIGQSNSEN
NDVDDLPDDTQVCSCHNVTKGKLIEKIKSGTCNSLGELKSCTKAGTACGGCEPTIKVILD
TEMKKMGKNISKALCIHYKESRQDLFSLIMVKRYKSFKEVMSHLGVDPCALGCEICKPTI
ASILATLFNRHILETNLHGLQDTNDKYLGNIQRNGTYSIVPRMSAGEVTPEKLVAIGEIA
RKYDLYTKITGAQRVDLFGASKSDLPKIWEELGKYGFESGQAYGKSLRNVKSCVGSTWCR
YGIGDSVGLALRLEERYKGIRSPHKMKGGVSGCVRDCAEFHSKDFGLCAVQNGFNLYVGG
NGGMKPAHAQLLKADVPPDQVIPLLDRYLMFYFRTADRLQRTARWLENLDGGIEYLREVV
VYDKLGIAMELEKQMNQLVSQYFDEWAAAVDSYKYSNIFKQFVNTDKAQETVEIIRDRGQ
RRPVDWPEYEVTKEVFKDTKWSSLSWVKVCQSKELPNSEAGSSANVLISDTQIAVYRLNG
KLFASQNMCGHKRAFVLSQGILSMDGNKNTYISCPLHKKNYIIDKASDKAGSCTNDASQS
VALFDVMESNGEVFVKLPPIEELDKVLGTSRWKVRKQESESNGSIATYKNIDEAFNIKVP
IRKPIPSVGCSGGPELDW
NT seq 3297 nt   +upstreamnt  +downstreamnt
atgaaaacttctgacgataatatttcattttctaaagggggggttccaccaacttccaaa
gaaatcagcgtcctcaaagatgattgcaataaaaaacatattataattgttggatttggg
atggttggattcgcatttttggagaagatgttagttgatgacacggccggagaatatagg
ttgacaataattggggatgaaccccatttagcctataatagggtcggcttgacagaatat
tttgagcatcaagattttgataagttgttacttgcacctcactcgttttacgatcaaaaa
aatgcagatacatgcgaatatagggttaatcaaaaagtaaccaaaatcgaaaaggagcat
aaatatatcgaaacatcaaatgcaaaaaggtaccattatgattatttggtccttgcaaca
ggatcttacgcagttttacccatagacttatttccccggtctcaaagcaacgaattctgc
gatttgaagagttgcaggaaattgggctgttttgtatatcgtacaattgatgacttgaac
gctatgatttcttttagtgaaacaatcagatcaacaataaagaaaccagtactaaaaaga
gcagttattgttggtggtggattattaggtctcgaagctgcgaaagcattactagatatg
gaatgctatgatgaagtaacaatagttcacaggtcaaagtggttattatcacagcaatta
gatgagaaaggtggtaatttattaactgaacgaattgcggaaatgggtgtcaagttaaga
acagacaccaccattaataaattacaatacgatcattgcacgctgtcgtttgaagtgcaa
tacaataatggtgacgtagaaatttgccaattgttatgttatactattgggattaaaccg
caagatatattggccagaagctcaggtttgaaagttgccaaaaaaggaggtatcgaagtt
gacaattttatgaaaacctcgaaccgctacatctatgcgataggtgagtgcgcatcatgg
aataatcaaacatttggtttgatagcacccggagtcatgatggcagacattttgtcattc
aacctcattcaggctaaataccattctgaacgtcagttcacaaagcctgatataggaact
aggttgaagcttatgggagtaaatgttgcgtcattcggtgattattttgcggataagaat
ggaccaagtaggttacccaaagggtataaaatcaaaaaagtcaaatctcttgtctatgat
gatccaattgaagccaattacactaagcttttattgagttatgatgggaaatacttactt
gggggaatattggttggtgataccactcaatttaccaaattggcatctattactaaaagt
gggaaaccattggaaaaacctgcatcaacctttatcattgggcaatccaactcagaaaac
aatgatgttgatgacttacctgatgatacccaagtatgttcttgtcataatgttacgaaa
ggaaaattaattgaaaaaattaaaagtggaacatgcaactcgcttggagaattaaagtcc
tgcaccaaagctggaacagcttgtggtggatgtgaacctacaataaaggtcatacttgat
acggagatgaaaaaaatgggtaagaatatttcaaaggcgttatgtatacattataaagaa
tcaagacaagatttattttccctaattatggttaagagatataagtcgtttaaagaggtt
atgtcccatttaggtgttgatccgtgcgctcttggctgcgaaatatgtaaaccgacaatt
gcatccatcttggcgacattattcaatcgtcatattttagaaacgaatttgcatgggcta
caggatacgaatgacaaatatttaggaaatatccaaagaaatggtacttattcaatagtt
cctcggatgagtgcaggagaggtcacccctgaaaaattggtcgctataggtgaaattgct
cgtaagtatgatttatacacgaaaatcactggtgctcaaagggtggacttattcggggct
tcaaaaagcgacctacctaagatctgggaagaattgggaaaatatggctttgaatctggt
caggcttatggtaaaagtttaaggaacgttaaatcatgtgttgggtctacatggtgccgt
tatggtattggtgattcagttggtcttgcattacgtttagaagaaaggtacaagggtata
aggtctcctcataaaatgaaaggtggagtgtctggatgcgttcgtgattgtgcagaattc
cactcgaaagatttcggattatgtgctgttcaaaatggatttaatctttacgtgggtggt
aacggaggcatgaaaccagcacatgcacaactactaaaagcagatgttccaccagatcag
gttatcccattattagacagatatttaatgttctattttagaaccgcagatcgtttacaa
agaaccgcaagatggttggagaatttagatggaggaatcgaatatttgcgagaagtcgtt
gtgtatgataagttgggaattgccatggaattggaaaaacaaatgaaccagctagtcagt
cagtacttcgatgagtgggctgctgccgttgattcttataagtatagcaatattttcaag
cagtttgttaataccgataaggcacaggagacagtagaaattattagagatagaggtcaa
cgacgtcccgtagactggccggaatatgaagttacgaaggaggtcttcaaggataccaag
tggtcttcattatcctgggtcaaagtttgtcaatccaaagaattacccaattcagaagca
ggatcatccgctaatgtattaatatctgatacccaaatagcggtatacagacttaatggt
aaattatttgcatcgcaaaatatgtgcggtcataaaagggcatttgttttatcccagggc
atcttgtcaatggacggtaacaagaatacttatatttcctgtcctttgcacaagaagaat
tatataattgataaggcaagtgataaggcaggttcgtgcacaaatgatgcatcacaatca
gtggcactatttgatgtgatggaatcaaatggtgaagtatttgtcaaactacctcccata
gaagaattggataaagttcttgggacttcaagatggaaggtcagaaaacaagaaagtgag
agtaatggttcaatagctacatataaaaatatcgatgaagcctttaacattaaggtacca
ataaggaaaccaattccctcagtaggatgttcaggaggaccagaattggactggtaa

DBGET integrated database retrieval system