KEGG   Debaryomyces hansenii: DEHA2G23430gHelp
Entry
DEHA2G23430g      CDS       T01026                                 

Definition
(RefSeq) DEHA2G23430p
  KO
K15435  2',3'-cyclic-nucleotide 3'-phosphodiesterase [EC:3.1.4.37]
Organism
dha  Debaryomyces hansenii
Brite
KEGG Orthology (KO) [BR:dha00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dha03016]
    DEHA2G23430g
Enzymes [BR:dha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.37  2',3'-cyclic-nucleotide 3'-phosphodiesterase
     DEHA2G23430g
Transfer RNA biogenesis [BR:dha03016]
 Eukaryotic type
  tRNA spricing factors
   Other tRNA splicing factors
    DEHA2G23430g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPDase
Motif
Other DBs
NCBI-GeneID: 2905514
NCBI-ProteinID: XP_462558
UniProt: Q6BGW3
Position
G:complement(1895068..1895781)
Genome map
AA seq 237 aa AA seqDB search
MTLMSSLNTLFPGQPPKFEPHITISSNIDVDLDHPDKTKSDVYRILSASLVAIDSLPKNH
SNLVTLGKVDSQRKFFKKLYFQVARDPNLVSFATIIRELFVQLPADIEQENMKKNPHLYT
TDSHGNTVKKKSKQSQDGRIEAIDMPRIQSEAQEQASLWSVTEFDPHLSLVYNDLHPIDS
ALWRTIKTRIQDYLNIDNCDSDDLTDNGLGWDNGILKLVLCEGDVNDWVVLGSADLH
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgactcttatgagttcactcaacaccttatttcccggtcaaccaccaaaattcgaacct
catataactatatcttccaacattgatgtagatttggaccatcccgataaaaccaaatcc
gatgtatacagaattttatcagcaagtttagttgcaatagattcgttaccaaaaaatcat
tccaatttggttacattaggaaaggtggacagtcagagaaagtttttcaaaaaattgtat
ttccaagttgcaagagatccaaatttagtatcctttgccactataatcagagaattattt
gtacaattaccagctgatatcgaacaagaaaatatgaagaaaaacccacatttgtacact
acggatagccatggaaataccgttaagaaaaagtcaaaacaatcacaagatggtaggata
gaagcgatagacatgcctagaatccagagtgaagctcaagaacaagcatccttgtggagt
gtcactgaattcgatccacatctttctttggtttacaacgacttacatcctatcgacagt
gcattgtggaggacaataaaaaccagaattcaagactatttgaatatagataattgcgat
tcagatgatttaacagataacggattaggctgggacaatggaatacttaaattagtttta
tgtgaaggtgatgtaaacgattgggtagttttgggtagtgccgacttgcactag

DBGET integrated database retrieval system