KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_0407Help
Entry
Dhaf_0407         CDS       T00822                                 

Definition
(GenBank) ribosomal protein L1
  KO
K02863  large subunit ribosomal protein L1
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
dhd03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dhd00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Dhaf_0407
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dhd03011]
    Dhaf_0407
Ribosome [BR:dhd03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Dhaf_0407
  Bacteria
    Dhaf_0407
  Archaea
    Dhaf_0407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L1 TPR_2
Motif
Other DBs
NCBI-ProteinID: ACL18474
UniProt: B8G1V1
Position
446907..447599
Genome map
AA seq 230 aa AA seqDB search
MAKVGKNYQEAVKAFDRAALHEPMEALAVVKKIAKAKFDETVEVAFKLGIDTRHADQQIR
GALVLPHGTGKTRSVLVFAKGDKAKEAEAAGADFVGAEDMIAKIEQGWFGFDVVVATPDM
MGMVGKLGRVLGPKGLMPNPKTGTVTFDVAKAVKEIKAGKIEYRADKAGIIHAPIGKVSF
SEEQLYQNYKVLVETLVKAKPAAAKGQYIRSVTVSSTMGPGVRINPVKAN
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagtaggtaaaaactatcaagaagcagttaaagcttttgaccgtgctgctctt
catgagcctatggaagctttagcagtcgttaagaagatcgctaaagcaaagtttgacgaa
actgttgaagtagcattcaagctcggtatcgatacccgtcatgcggaccaacaaatccgt
ggagcccttgtgcttcctcacggaaccggtaaaacccgcagtgtgttagtcttcgctaaa
ggcgataaagctaaagaagctgaggctgccggtgcagattttgttggtgctgaagacatg
attgcgaaaatcgagcagggttggtttggtttcgatgtggttgttgctacaccggatatg
atgggtatggtcggtaaactgggtcgtgtgctcggtcctaaaggacttatgccaaacccc
aagaccggtaccgttacctttgatgtagccaaagctgtcaaagagatcaaagccggtaag
attgaatatcgtgctgacaaagccggtatcattcatgcccctatcggcaaagtttccttc
agcgaagaacaactctatcagaactataaggttctggttgagaccttggttaaagcgaag
ccggctgccgctaagggtcagtatatccgcagcgtcacagtgtcctctactatgggacct
ggagtacggattaacccggtcaaagccaattaa

DBGET integrated database retrieval system