KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_0602Help
Entry
Dhaf_0602         CDS       T00822                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
dhd00071  Fatty acid degradation
dhd00280  Valine, leucine and isoleucine degradation
dhd00310  Lysine degradation
dhd00362  Benzoate degradation
dhd00380  Tryptophan metabolism
dhd00620  Pyruvate metabolism
dhd00630  Glyoxylate and dicarboxylate metabolism
dhd00640  Propanoate metabolism
dhd00650  Butanoate metabolism
dhd00720  Carbon fixation pathways in prokaryotes
dhd00900  Terpenoid backbone biosynthesis
dhd01100  Metabolic pathways
dhd01110  Biosynthesis of secondary metabolites
dhd01120  Microbial metabolism in diverse environments
dhd01130  Biosynthesis of antibiotics
dhd01200  Carbon metabolism
dhd01212  Fatty acid metabolism
dhd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dhd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dhaf_0602
   00630 Glyoxylate and dicarboxylate metabolism
    Dhaf_0602
   00640 Propanoate metabolism
    Dhaf_0602
   00650 Butanoate metabolism
    Dhaf_0602
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Dhaf_0602
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Dhaf_0602
   00072 Synthesis and degradation of ketone bodies
    Dhaf_0602
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dhaf_0602
   00310 Lysine degradation
    Dhaf_0602
   00380 Tryptophan metabolism
    Dhaf_0602
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dhaf_0602
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Dhaf_0602
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Dhaf_0602
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dhd04147]
    Dhaf_0602
Enzymes [BR:dhd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Dhaf_0602
Exosome [BR:dhd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dhaf_0602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACL18668
UniProt: B8FV22
Position
complement(658680..659987)
Genome map
AA seq 435 aa AA seqDB search
MSFVKSKEDIVCVSAVRTPFGKFGGSMKDIDVYELGAIAMSKAMAKISLDPALIDEVWWG
NGDTSSTKDPFTPVVARQTMLKAGISPETPSITYDQACTSALSTVKYGARSIKLGEAQMV
MTGGSTSFSTVPFLLRDIRWEGKKHSSFLVEDPIIPLGYKDYAPVAVDSGNVAVEYGVSR
QEQDELALASHVKYGQAWERGFFKGEMEPLEITKKDKKGKVLSAQLLAKDEQYRPEISME
NLARLKPIFDNPTCTAGNAPGMNDGAAAQIITTREHAEQLGLPILYTLVGISAIALQPRI
MPVSPAFAIKKCLDEAKLTIDDLKVIEINEAFACVPLVSLKLLANERFLTSDYKAMVKEA
SAQPILDHDPERYLKLKEKLNPNGSAIAVGHPNTASGARLMMTAAYQLQETGGGYAACAI
CGGLTQGAGAIIWVE
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgagctttgtcaaaagtaaagaggatatcgtttgtgtcagtgccgtgcggactcctttc
ggcaaattcggcggctccatgaaggatatcgatgtctacgaactgggggccattgccatg
agcaaggctatggccaagatcagcctggacccggccctcatcgatgaggtatggtggggc
aacggcgataccagcagcaccaaagatcccttcacaccggtggtggcgcgccagaccatg
cttaaagccggcatctcaccggagaccccgtccatcacctacgaccaggcctgcacctca
gccctgagcaccgttaaatacggcgcccgcagcatcaaactgggggaagcccaaatggtc
atgaccggaggttccaccagcttcagcacggtgccctttttgctccgggatatacgctgg
gaaggaaaaaagcattcttcctttctggtggaagacccgattattcccttgggctataag
gattatgcacctgtagcggtagattccggcaatgtcgctgtggagtatggggtatcccga
caggaacaggatgagctggccctggccagccatgtcaaatacgggcaggcctgggaacgg
ggatttttcaagggtgaaatggagcccctggagattacgaaaaaggacaaaaaagggaaa
gttctctccgctcaactcctggctaaggatgaacaataccgccctgagatcagtatggag
aatctggcccgcttaaaacccattttcgacaacccgacctgtaccgcaggcaatgctccg
ggaatgaatgacggagctgccgctcagatcattaccaccagagaacatgccgagcaattg
gggctgccgattctgtatactctggtgggaatttccgccatcgccctgcagccgagaatt
atgccggtatcccctgctttcgctattaagaaatgcctggatgaggccaagctgactatc
gacgacctgaaggtcatcgaaatcaatgaagcctttgcctgtgttcccttggtctccctg
aagctcctggccaatgaacgcttcttaaccagcgactataaggcgatggtcaaagaagct
tcagcccaacccatcctggatcatgatcctgagcgctatctgaagctgaaggaaaagctc
aaccccaatggaagcgccatcgccgtaggtcatcctaacacggccagcggggcccgcctg
atgatgacagcggcctatcagctccaggaaacgggcggaggctatgccgcctgcgccatc
tgcggcggtttaacccagggcgccggagcgatcatctgggtggagtaa

DBGET integrated database retrieval system