KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_0861Help
Entry
Dhaf_0861         CDS       T00822                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
dhd00260  Glycine, serine and threonine metabolism
dhd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dhd01100  Metabolic pathways
dhd01110  Biosynthesis of secondary metabolites
dhd01130  Biosynthesis of antibiotics
dhd01230  Biosynthesis of amino acids
Module
dhd_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dhd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dhaf_0861
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dhaf_0861
Enzymes [BR:dhd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dhaf_0861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACL18924
UniProt: B8FX38
Position
complement(953536..954903)
Genome map
AA seq 455 aa AA seqDB search
MTKTPYKIYLSEEEMPKSWYNLKAVMKELPPPMLHPGTLKPCTIEDLQPVFCDELIEQEL
NTKDLYIEIPEDIRDFYKMYRPSPLVRAYCLEKLLDTPAEIYYKFEGTNTSGSHKLNSAA
AQVYYAKKQGLTSLTTETGAGQWGTALSMACAYYQIDLTVYMVKISSEQKPYRKAVIETY
GGKVIPSPSDTTEIGKKILAENPGTGGSLGCAISEAIEVALKSENCRYVLGSVLDHVVLH
QTVIGEETKIACEKYGIQPDIMIGCVGGGSNYAGLIAPFFGDKLQGKNNITFIGVEPASC
PSLTRGKYAYDFGDTGKTTPLLKMYTLGSGFIPSPNHSGGLRYHGMSGIVSKLYHDGLME
ARAVEQSKIFDAATLFARSEGILPAPESSHALRVAIDEALKCKETGEKKTILFGLSGTGY
FDLSAYMNYNAGTMTDFIPTDEDLEKSFATLPKVD
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaacaccttacaaaatctatctctccgaagaggaaatgccgaaaagctggtac
aacttgaaggctgtaatgaaggaactcccccctcctatgcttcaccctggaacgctgaag
ccctgcaccatcgaagatctgcaacctgtgttttgtgatgagttaatcgaacaggaatta
aacaccaaagatctttatattgagatccctgaagatatacgggacttctataagatgtac
cgtccttcacccctggtcagagcttattgcctggaaaagctgctggatactcccgcggag
atctactataaatttgaaggaaccaatacctccggctcccacaaactcaactcagctgcc
gcccaggtctactatgctaaaaaacaaggtttaacttcccttactacagaaaccggcgct
gggcaatggggtacggccctatccatggcctgtgcctattatcaaattgatctcaccgtc
tatatggtgaagatctcctctgaacagaagccctatcgcaaggctgtgattgagacttat
ggtggtaaggtcatcccctctccctccgacaccacagaaatcggaaaaaaaatcctcgcc
gaaaatcccggcaccggcggctccctgggatgcgctatctccgaagccatcgaagtagct
ctaaaatctgagaattgccgctatgtcctgggcagtgtccttgatcatgtggttctccac
caaacagtgatcggtgaagagaccaagattgcctgcgaaaagtacggtattcagcccgat
attatgatcggctgcgtaggaggcggctccaactatgccggcctgattgcccccttcttc
ggagataaactccaaggaaaaaataacattacctttatcggtgtagagcctgcctcttgt
ccatctttaacccggggtaaatatgcctatgattttggcgatacaggaaaaaccactcca
cttcttaaaatgtatactttgggctcaggattcattccctcccctaaccattccggtggt
cttcgctaccacggcatgagcggcatagtatccaagctctatcatgatggccttatggaa
gcccgggcggttgagcaatctaagatcttcgatgctgctactctctttgcccgcagtgaa
ggaattctccctgcccctgaatcctcccacgcgctgcgggtagccatcgatgaagcccta
aaatgcaaagagaccggagagaagaaaaccattcttttcgggctttccggcaccggatac
tttgatctgtccgcttatatgaattataacgcgggcaccatgaccgactttatccctacg
gatgaagacttagaaaagagctttgctactttgcctaaagtagactaa

DBGET integrated database retrieval system