KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_1050Help
Entry
Dhaf_1050         CDS       T00822                                 

Definition
(GenBank) nitrogenase molybdenum-iron protein alpha chain
  KO
K02586  nitrogenase molybdenum-iron protein alpha chain [EC:1.18.6.1]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
dhd00625  Chloroalkane and chloroalkene degradation
dhd00910  Nitrogen metabolism
dhd01100  Metabolic pathways
dhd01120  Microbial metabolism in diverse environments
Module
dhd_M00175  Nitrogen fixation, nitrogen => ammonia
Brite
KEGG Orthology (KO) [BR:dhd00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Dhaf_1050
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Dhaf_1050
Enzymes [BR:dhd01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.6  With dinitrogen as acceptor
    1.18.6.1  nitrogenase
     Dhaf_1050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: ACL19110
UniProt: B8FZN6
Position
1144697..1146130
Genome map
AA seq 477 aa AA seqDB search
MSISEMVQARKELVNQVLEVYPEKAKKNRRQHLSVKESDCSSCAVKSNGKTVPGIMTARG
CAYAGAKGVVWGPVKDIVHISHGPVGCGFYSWANRRNLAEGEVGIDNFVPFQFTSDFQES
DIIYGGDKKLEKIIEEVVELFPNAKGVSVLSECPVGLIGDDIESVARRMTEKTQRPVVPV
RCEGFRGISQSLGHHIANDAIRDHIIGKGPEREIGPYDIGIIGDYNIGGDAWASKKILEE
IGLNVVNIWTGDSTLEMLQNGHLVKLNLIHCYRSMNYMANYMEETYGTPWLEFNFFGPTK
IKESLLNIAAHFDDSIRENTQRVIAKYEAQMQKVIDIYRPRLAGKKVMLYVGGLRPRHVV
GAYEDLGMEIIGTGYEFAHKEDYERTYPQLKEGTLIYDDVSALELEEFVKDLKPDLVGSG
IKEKYVFEKMGLPFRQMHSWDYSGPYHGYDGFPIFARDMDMAVNSPTWKSIKAPWMK
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcagtgaaatggtccaggccagaaaagaactggtcaatcaagtgttggaagtc
tatccggaaaaggctaagaaaaaccgcaggcagcatctttctgtcaaagaaagtgattgc
tcaagctgcgctgttaagtccaatgggaaaaccgtaccgggaatcatgaccgcccggggc
tgcgcttacgccggagccaaaggggttgtgtgggggccggtcaaggatatcgtgcatatt
tcccacgggccggtggggtgcgggttttattcctgggctaaccgccggaacctggcagaa
ggtgaagtgggcatagacaatttcgtacccttccaattcacctcggacttccaggagagc
gatatcatctacggcggggacaaaaaactggagaagatcattgaagaggtcgtcgaactg
ttccccaatgccaaaggagtttccgtactgtccgaatgccctgtggggctgatcggagac
gatatcgaaagtgtcgcccgccggatgacggagaaaacccagcgccctgtggtgccggtg
cgctgcgaagggttcaggggaatcagtcagtccctcggtcaccatattgccaatgatgca
attcgcgatcatatcatcggcaaggggccggagcgggaaatcggaccctacgatattggg
attatcggcgattacaatatcggtggtgatgcctgggccagcaaaaaaatcctggaagaa
atcggcttgaatgtggtgaatatctggaccggtgattctactctggaaatgcttcagaac
gggcatctggtcaaactgaacttaatccattgctaccggagtatgaactatatggccaac
tatatggaggaaacctacggaaccccctggctggaattcaatttcttcggacccacgaag
attaaggaatccctgcttaacattgcagctcattttgacgactccattagggagaatacc
caaagagtcattgccaaatatgaagcccagatgcaaaaagtaatcgatatctaccggccc
cgtttggccggcaaaaaggtcatgctgtatgtaggcggccttcgcccccggcatgtggtg
ggcgcttatgaagatttgggcatggagattatcggtacgggctatgagtttgcccataag
gaggattacgaacggacttacccccaattgaaggaaggaacccttatttacgatgatgta
tccgctttggaactggaagagtttgttaaggatcttaagccggatctggtgggctcggga
attaaggaaaagtatgtctttgaaaaaatgggcctgcctttccgccagatgcactcctgg
gattactccggaccttatcacggttatgatggattccccatttttgcccgggatatggat
atggcggtgaacagtcccacctggaagtccattaaagctccttggatgaaataa

DBGET integrated database retrieval system