KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_2476Help
Entry
Dhaf_2476         CDS       T00822                                 

Definition
(GenBank) HAD-superfamily hydrolase, subfamily IA, variant 1
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
dhd00625  Chloroalkane and chloroalkene degradation
dhd01100  Metabolic pathways
dhd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dhd00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Dhaf_2476
   00361 Chlorocyclohexane and chlorobenzene degradation
    Dhaf_2476
Enzymes [BR:dhd01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     Dhaf_2476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like DUF3417
Motif
Other DBs
NCBI-ProteinID: ACL20504
UniProt: B8FU90
Position
2673540..2674217
Genome map
AA seq 225 aa AA seqDB search
MYKALFFDVDDTLLNFEQCSREALGKTFRHFSMDYDDTVYELFRSIDQRLWLQQKQGELT
VQDVINLRFQELFKQLQLGCSHIPLQTMFQERLAEEFFTEPHAAESLGYLSARYQLFVTS
NGILKTQLKRLELAGLLPYFTDVFVSDHIGHEKPSVRFFEECLQRSRLKPSEVLLIGDSL
EADMVGAQTSKMDSCWYNPKHRNTDSDVEIDYIISDLLQLKDILQ
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
gtgtataaagctttattctttgatgtggatgataccctgctgaatttcgaacagtgtagc
agggaagcactgggcaagacattccgtcatttcagtatggactacgatgacaccgtttac
gagctgttccgcagcatagaccagcgattatggcttcagcaaaagcaaggcgaacttacc
gttcaggatgtcatcaatcttagatttcaagaattatttaaacagctccagcttgggtgt
tctcatatccctttgcagacgatgttccaggagagattggcggaagagtttttcactgaa
ccccatgcggcagaatccctgggctatttaagcgctcgctaccaactctttgtgacctcc
aacggtattttgaaaacccagttgaagcgtctggagttagccggcttattgccgtatttt
acagatgtatttgtctctgaccatatcggccatgaaaagcccagtgtccggttttttgag
gagtgcttgcaaagaagcaggttgaagcccagcgaggtgctgctcatcggcgatagcctt
gaagcggatatggtcggggcccaaaccagcaagatggactcttgctggtataatcccaag
cataggaacacggattctgatgttgagattgattatattatttcagatttgctgcagctt
aaagacatactgcaataa

DBGET integrated database retrieval system