KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_2792Help
Entry
Dhaf_2792         CDS       T00822                                 

Definition
(GenBank) dihydropteroate synthase DHPS
  KO
K15023  5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase [EC:2.1.1.258]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
dhd00720  Carbon fixation pathways in prokaryotes
dhd01100  Metabolic pathways
dhd01120  Microbial metabolism in diverse environments
dhd01200  Carbon metabolism
Module
dhd_M00377  Reductive acetyl-CoA pathway (Wood-Ljungdahl pathway)
dhd_M00618  Acetogen
Brite
KEGG Orthology (KO) [BR:dhd00001]
 09100 Metabolism
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Dhaf_2792
Enzymes [BR:dhd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.258  5-methyltetrahydrofolate---corrinoid/iron-sulfur protein Co-methyltransferase
     Dhaf_2792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind CdhD
Motif
Other DBs
NCBI-ProteinID: ACL20816
UniProt: B8FX97
Position
complement(2997616..2998410)
Genome map
AA seq 264 aa AA seqDB search
MIIIGERINGMFKDIGDALRNKDAKPLQHWALKQEEGGAHYLDVNSGPAVPKEERPEAYE
WMVKVIQEVSNLPLCLDSTNYDAIEAGLKHLKRPGMINSVPAERDKIERVFPMAVQYNAS
LIGLTMDKVGIPKDAENRIVFAMELVAAADEFGLPTDELYIDPLILPCNVAQEHAPEVLE
AIRMVKTLSNPAPKTVLGLSNVSQKSPDRHLINRTYLAMAMAAGLDAAIMDANDDDLVDV
AATGQILLNKSIYADSYLKVFRQR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
ttgattattattggtgaacggattaatggaatgtttaaggatatcggagacgctcttcgc
aataaggatgccaagccccttcaacattgggcattgaaacaggaagaaggcggagcccat
taccttgacgttaactccggtccggcagttcccaaagaggagcgtcctgaagcctatgag
tggatggttaaggttattcaagaagtctccaacctgcctctgtgcctggattccacgaac
tatgatgccattgaagccggtttaaagcatctcaaacgccctggcatgatcaattcagtt
cctgccgagcgtgacaagattgagcgggttttccccatggctgtccaatataatgcatcg
ttaatcggtttgaccatggataaagtagggattcccaaagatgccgaaaaccgtattgtt
ttcgccatggaattggtggctgcagcggatgaattcggcttacctaccgatgaactctat
attgaccccctgatcctgccttgtaatgttgcccaagagcacgcacctgaggttttggaa
gccatcagaatggtcaaaaccctgtccaacccagccccgaaaaccgttctgggcctttcc
aacgtgtcccagaaatctccggaccgccatctgatcaatcgcacctatctggccatggct
atggctgccggcctcgatgcggcgattatggatgccaacgatgacgatttggttgacgta
gctgcaaccggtcaaatcctcttaaataagagcatctatgctgattcttacctgaaggtt
ttccgccagcggtag

DBGET integrated database retrieval system